PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G182900.1
Common NamePHAVU_003G182900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SBP
Protein Properties Length: 550aa    MW: 60291.1 Da    PI: 6.9596
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G182900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1352.3e-42172247277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Phvul.003G182900.1 172 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTATVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 247
                         **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-33166233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-39170249IPR004333Transcription factor, SBP-box
PfamPF031102.0E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MESWSFVPEE KECVSNEALS PPNTLGRTIN SFLGWELKTP CGFSNEMLGL GQHTIENQGF  60
EELGFPEMLG KHLSDDLIAS VSSRKVDAGR QHQPSDRITG TVVDAPSGFS QRGDSNSKLS  120
NSNSLIDLKL GRFADHGDAI DPGFSKVLSS SESSTPPKRA RVSGVHSQTA YCQVYGCNKD  180
LSSCKDYHKR HKVCEVHSKT ATVIVNGIEQ RFCQQCSRFH LLAEFDDGKR SCRKRLAGHN  240
ERRRKPQMGI HPGKSGRLLQ PCGDSRFQGT MLTSSFIRPE MLPSGVMCSE KYGMSGFWRH  300
IKAEHGAGFR HLSSMPVSNG HPQSRSLFPS YNGKQFPFLQ ENCATSTTGS IFCESNSHYP  360
PTLRAQDSGL RPLFQDTIGN EDFNVFDTAS TVQGLSGISD SCCALSLLSS QSQNSSSQSS  420
GIPLVHSLVI PSSHGHHYSM SQVSEKIGIS SQTSSSRVSD SFPSELNHAD GSHLSPVLIS  480
DHNDIVNFDM TDGIFHGSEF MNVKDRLSCE DGATIDLLQL SSQLQRVEHE RQSMQVKQEN  540
DSSCTLRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291722451184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G182900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155210.10.0hypothetical protein PHAVU_003G182900g
TrEMBLV7CAP80.0V7CAP8_PHAVU; Uncharacterized protein
STRINGXP_007155210.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-52SBP family protein