PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G181500.1
Common NamePHAVU_003G181500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family bZIP
Protein Properties Length: 211aa    MW: 23965.9 Da    PI: 7.0798
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G181500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.85.4e-14103162463
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +++ +r+ +NRe+ArrsR RKk++ie L+  v+ L++ N++L +++  l +  ++  +++
  Phvul.003G181500.1 103 DRKKKRMFSNRESARRSRMRKKQQIELLQYHVDHLQTLNHQLSEKIIYLLECNQQIHQQN 162
                         7899****************************************9977777666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-12100164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.231102165IPR004827Basic-leucine zipper domain
PfamPF001709.4E-13103162IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-13104161No hitNo description
SuperFamilySSF579593.38E-11104160No hitNo description
CDDcd147022.90E-14105153No hitNo description
PROSITE patternPS000360107122IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MECNEDDELH VAPYASLTQC FRYLSPTQKP ILTSTMETDE GHTLTHLDQP HSLHHIPFFY  60
SQLHLPSTSH NPIQVPLHKS SPNTSSNSNN NNNSDEAKAL LDDRKKKRMF SNRESARRSR  120
MRKKQQIELL QYHVDHLQTL NHQLSEKIIY LLECNQQIHQ QNAQLKEKVS SLQVALSDLL  180
VPEGGAEQPH HIPNGFLVEP STRAIASSIV *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G181500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155196.11e-154hypothetical protein PHAVU_003G181500g
TrEMBLV7CD571e-153V7CD57_PHAVU; Uncharacterized protein
STRINGXP_007155196.11e-154(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.14e-29basic leucine-zipper 70