PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G159800.1
Common NamePHAVU_003G159800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 451aa    MW: 49207.2 Da    PI: 7.2775
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G159800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32244299156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Phvul.003G159800.1 244 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 299
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.02E-17241302IPR009057Homeodomain-like
PROSITE profilePS5129413.355241301IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-28242302IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26244299IPR006447Myb domain, plants
PfamPF002497.8E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MASPSELSLD CKPQSYSLLL KSFGDQTDQT YKLEEFLSRL EEERLKIDAF KRELPLCMQL  60
LTNAMEASRQ QLQAFKVNHG AKPVLEEFIP MKHLASESSE KAINMSDKAN WMTSAQLWSQ  120
ASEGTKQQPT LTSPKEADIG FSISPKLALD SKQRNGGGAF LPFSKERNSC QGSTLRPLPE  180
LALASSEKEM EDKKRAEVEK GVSCQNKKEN SGSDGAVVDQ GKSGSPVASS LAQTTTTTAQ  240
THRKARRCWS PDLHRRFVNA LQMLGGSQVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT  300
RRPSPSPQAS SAAPQLVVLG GIWVPPEYAT AAHTATPTLY GAHPTSHAPP PHYCTATPVP  360
QEFYTAAPQQ QLLPPPPPHH NALHHLHMYK AATHGHGSPD SEVPGCGERS ESIEDGKSES  420
SSWKGESGEN EGERKGIGEE SNGSEITLKF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14244297154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14244297154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14244297154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14244297154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G159800.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154940.10.0hypothetical protein PHAVU_003G159800g
SwissprotQ9ZQ851e-131EFM_ARATH; Myb family transcription factor EFM
TrEMBLV7C9V60.0V7C9V6_PHAVU; Uncharacterized protein
STRINGXP_007154940.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-109G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]