PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G158200.1
Common NamePHAVU_003G158200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ARR-B
Protein Properties Length: 678aa    MW: 74541.2 Da    PI: 5.4052
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G158200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.71.4e-24209262155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k rl+W  eLH++F+ a++qL G+ekA Pk+il+lm+++gL++e+v+SHLQk+Rl
  Phvul.003G158200.1 209 KSRLVWDAELHNKFLAAINQL-GIEKAFPKKILDLMNIDGLSRENVASHLQKFRL 262
                         68*******************.********************************8 PP

2Response_reg791.6e-26131211109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+++ + +l+++l+k +y +v++++++ +ale+l++++  +Dl++ D++mp+mdG++ll++   e  +lp+i+++++g++e + + 
  Phvul.003G158200.1  13 VLAVDDDRTYLTVLENLLRKCQY-NVTATTEAVKALEMLRKNRnmFDLVVSDVNMPEMDGFKLLQHVGLET-DLPVIMLSGYGDKERVMKG 101
                         799********************.***************99999***********************7766.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga dfl+Kp+ ++el +
  Phvul.003G158200.1 102 VIYGACDFLTKPVRIQELQN 121
                         *****************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.5E-1381676IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23008.0E-4010139No hitNo description
SuperFamilySSF521722.85E-3410131IPR011006CheY-like superfamily
SMARTSM004489.5E-3011123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.00712127IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.1E-2413121IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.18E-2614126No hitNo description
PROSITE profilePS512949.902206265IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-24207266IPR009057Homeodomain-like
SuperFamilySSF466896.09E-17207266IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-22209262IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MEEEDHFPVG LRVLAVDDDR TYLTVLENLL RKCQYNVTAT TEAVKALEML RKNRNMFDLV  60
VSDVNMPEMD GFKLLQHVGL ETDLPVIMLS GYGDKERVMK GVIYGACDFL TKPVRIQELQ  120
NIWQHVVRRK IDGKDKNKTA SEEINCSMSG KVANEEEPCT IAGECSQALE PKTNADQNIK  180
GDRKRKERCE AEEVEEDDKE NDEPSNHKKS RLVWDAELHN KFLAAINQLG IEKAFPKKIL  240
DLMNIDGLSR ENVASHLQKF RLGLKKPNPY HRMGSVDCFR PSSESGSMLS TTLPSYAYAP  300
GGRFGVLNAP SSLNTRGMNS SAIVQAAQSL NINSSSIKTH GNMHSSIFSA NQTSSLLQGI  360
PTSIEANQFK PNNSPAGIRR FNLLDRSTGF KDFSSFSENR ATVRNAANVS LPGFSNNHLL  420
FQGISQLTHH SEPFRNHSSF GSASVKAQSF DPNSCGWPKM GDDYNNKSWQ GAAPISIFPS  480
STSAVSNVFN DDQLLQHNFK LSPSTFCSRN SPVGFSSSVP LEDDVLGEML QQEGLHGNIL  540
LASSYTQHNK GGCSKDTSQT FNSINPVISP NGGTSSLGHC YDQNNAVDNK SIDASLVGQM  600
NGVNPSITQS SEGENFYSMK SNDEYVLPSL KSGEGLLHNG LESLDEIMNE IDEQELNAIM  660
LMDGGIEFDA YNDGSCK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-24207266362ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G158200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154913.10.0hypothetical protein PHAVU_003G158200g
SwissprotB8B3I44e-95ORR22_ORYSI; Two-component response regulator ORR22
TrEMBLV7C9P80.0V7C9P8_PHAVU; Two-component response regulator
STRINGXP_007154913.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-92response regulator 12