PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G075800.1
Common NamePHAVU_003G075800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ARF
Protein Properties Length: 654aa    MW: 73276.8 Da    PI: 6.3848
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G075800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.79.5e-23127227198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F  
  Phvul.003G075800.1 127 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGNEWHFRHIFRGQPKRHLLTTGWSVFVSSKKLVAGDAFIFL- 214
                         99****************************964333..4459************************************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          +++++el+v+v+r
  Phvul.003G075800.1 215 -RDENGELRVGVRR 227
                         .5699999****98 PP

2Auxin_resp112.73.6e-37253335183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t++ F+v+Y+Pr+s+seF+v+v+k+++a ++k+svGmRfkm+fe+++ +err+sGt+vgv d +++ Wp+S+WrsLk
  Phvul.003G075800.1 253 ASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAKSHKLSVGMRFKMRFEGDEIPERRFSGTIVGVGDNKSLVWPDSEWRSLK 335
                         789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-43118256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-41119242IPR015300DNA-binding pseudobarrel domain
CDDcd100174.64E-20125227No hitNo description
PROSITE profilePS5086311.547127229IPR003340B3 DNA binding domain
SMARTSM010199.3E-23127229IPR003340B3 DNA binding domain
PfamPF023621.6E-20127227IPR003340B3 DNA binding domain
PfamPF065073.0E-35253335IPR010525Auxin response factor
PfamPF023093.9E-12537628IPR033389AUX/IAA domain
PROSITE profilePS5174526.293538631IPR000270PB1 domain
SuperFamilySSF542771.81E-10541615No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MAFSASTHKS AGLLPGAIND DLYKELWHAC AGPLVTLPRE GERVYYFPQG HMEQLEASMY  60
EGLEQQMPSF NLPSKILCKV VNVHLRAESE TDEVYAQITL LPELDQSEVT SPDDPLTESP  120
RVKIHSFCKT LTASDTSTHG GFSVLRRHAD DCLPPLDMSQ QPPWQELVAT DLHGNEWHFR  180
HIFRGQPKRH LLTTGWSVFV SSKKLVAGDA FIFLRDENGE LRVGVRRVMR QQSNVPSSVI  240
SSHSMHLGVL ATASHAIATG TLFSVFYKPR TSRSEFIVSV NKYLEAKSHK LSVGMRFKMR  300
FEGDEIPERR FSGTIVGVGD NKSLVWPDSE WRSLKVQWDE PLSILRPDRV SSWELEPHVS  360
TTPANPQPTQ RNKRARPLIL TSTMPDSSLQ GMWKSPVEST SFSYCDPQHG RGLYPSPKFN  420
PSATILGFSG NGFVGPPSNK SIYWSNRVQN FLESMSDTVP KEAGEKRQDT GNGCRLFGIQ  480
LLENSNAEEC LQTVTLSGRL GDDRFVPSLD AESDQPSVSC DAEKSCLSPQ ELQSRQIRSC  540
TKVHMQGMAV GRAVDLTRFH GYQDLLKKLE EMFDIKTELC GSIKKWQVVY TDNEDDTMMV  600
GDDPWDEFCS VVRKIFIYTA EEVKKLSPKI GLSMNENRTS NPEEQSSNMG PSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.053572354Auxin response factor 1
4ldw_A0.053572354Auxin response factor 1
4ldw_B0.053572354Auxin response factor 1
4ldx_A0.053572354Auxin response factor 1
4ldx_B0.053572354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153915.10.0hypothetical protein PHAVU_003G075800g
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLV7C6Z50.0V7C6Z5_PHAVU; Auxin response factor
STRINGGLYMA07G40270.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68022638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1