PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G039600.1
Common NamePHAVU_003G039600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SBP
Protein Properties Length: 481aa    MW: 53905.9 Da    PI: 6.8775
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G039600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.24.1e-42178254177
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         +Cqv gC++dls+ k+yh+rhkvC++hsk+++v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  Phvul.003G039600.1 178 VCQVYGCNMDLSSSKDYHKRHKVCDAHSKTAKVIVNGLEQRFCQQCSRFHVLAEFDDGKRSCRRRLAGHNERRRKPQ 254
                         6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-34173240IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.761176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.19E-40177258IPR004333Transcription factor, SBP-box
PfamPF031107.3E-32179252IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MESWSYVPEE KGYLFSDEMD FSLDAFMRSR RTLVEWDNKS NFERDGFNSD REVVKSMEFV  60
DLGFPDLLQK SFHGSQPLET SSYELDSNSS KRGNSSTHVI ALDSTMGEEE SDSKHLSSLV  120
EAKIHDSSLI DLKLGRLADC KGASSDKVTK EGFTLTSIHQ TTLSKRARTS SLSAQAPVCQ  180
VYGCNMDLSS SKDYHKRHKV CDAHSKTAKV IVNGLEQRFC QQCSRFHVLA EFDDGKRSCR  240
RRLAGHNERR RKPQFDYMTG KQHKILQSYQ GTKYLGTSLQ NKPQFPFQNI FQSGILFPGK  300
HAQNSQNGRI KLEEDSLYSS QLAAPVTLGQ ELSSCALSLL SDQSQYPSRH AAGNPLASSP  360
ILHGIHIQDR DDLVSETSLR ITSSADKYAP NESFSCNTAS KEVIKNQSAP FSNAGHALQD  420
HHGDDICQPS DLFDVKHRLS SEHGATVDLF QLSSHLQRVE QQRNSVLVKW ENEDYCFPTV  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29170252284squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G039600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153485.10.0hypothetical protein PHAVU_003G039600g
TrEMBLV7C5R00.0V7C5R0_PHAVU; Uncharacterized protein
STRINGXP_007153485.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-66SBP family protein