PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G028000.1
Common NamePHAVU_003G028000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 374aa    MW: 41398.1 Da    PI: 6.7998
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G028000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31212267156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W++eLH+rF++a++qLGG++ AtPk+i+elmkv+gLt+++vkSHLQk+Rl+
  Phvul.003G028000.1 212 KQRRCWSQELHKRFLHALQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLH 267
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-28209270IPR009057Homeodomain-like
PROSITE profilePS5129412.783209269IPR017930Myb domain
SuperFamilySSF466896.63E-18210270IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-27212267IPR006447Myb domain, plants
PfamPF002491.2E-6214264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MLPLKMGFRE YIEALEEERR KIQVFPKELP LSLELVTQAI EGCRQQLSGT VTEYNLNGQS  60
ECSEQTSTDE GPVFEEFIPI KKMASQDSVE EEEEEENEDE VEDEQHSHQH RKTTSDKRKS  120
DWLRSVQLWN PNPPPTKEDV PRKANVVEVK RNGGAFQPFQ REEKSGVVDG KVNNYASAIG  180
KAPSSPPVPA TSSTGPVRID SKKEEKGQAQ RKQRRCWSQE LHKRFLHALQ QLGGADSATP  240
KQIRELMKVD GLTNDEVKSH LQKFRLHTRR SPIMHNNASS QAAPLFLVGN IFVQPPEYGA  300
VATSSASGGE LTTVTAPTGI YAPVAAHPPP VTNTPIMKHL HSQERPHNHH SAQSNSPASS  360
SSTHTITTTS CAP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G028000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311800.0KT031180.1 Glycine max clone HN_CCL_160 MYB/HD-like transcription factor (Glyma02g10940.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153350.10.0hypothetical protein PHAVU_003G028000g
TrEMBLV7C5E60.0V7C5E6_PHAVU; Uncharacterized protein
STRINGXP_007153350.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-79G2-like family protein