PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G008800.1
Common NamePHAVU_003G008800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SBP
Protein Properties Length: 1010aa    MW: 111882 Da    PI: 8.1939
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G008800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-4088165178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Phvul.003G008800.1  88 MCQVDNCREDLSKAKDYHRRHKVCEAHSKASKALLANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 165
                         6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-3483150IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.88986163IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-3787167IPR004333Transcription factor, SBP-box
PfamPF031109.1E-3089162IPR004333Transcription factor, SBP-box
SuperFamilySSF484038.39E-7756894IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-5757902IPR020683Ankyrin repeat-containing domain
CDDcd002046.04E-4803893No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1010 aa     Download sequence    Send to blast
MEKVAAPPIL MPRKRDLPYG VVAGSPGESW KWDWDSVRFA GKPPADDVVF EEESVAAAAA  60
PLQLNLAGRV GGNKRVRSGS PGAATYPMCQ VDNCREDLSK AKDYHRRHKV CEAHSKASKA  120
LLANQMQRFC QQCSRFHPLS EFDEGKRSCR RRLAGHNRRR RKTQPEDVTS ATPAPAAAAA  180
NLEIFNLLTA IAGASQGKFE ERRSQVPDRE QLVQILNRIP LPADLATKLL DAGNVNGKKD  240
HVQSQTPSSY HHHDQLNHTP AAPLTMDLLA VLSTTLSGSG PDANASPSQN RSCSSDGGSV  300
KSRSCADQTR QQHFFSVGGE RSSSSSQSPV EDSDCQEDVR VNLPLQLFSS SPEEDSLPKL  360
ASSRKYFSSD SSNPAEERSP SSSPPSPPVV EMQFDLQGGA RGLKPESISS GRGVNSNKET  420
SQSHSCNISL DLFKGSNNRI QQPSWLQSVP FQAGYTSSGS DHSPPSLNSD AQDHTGRIMF  480
KLFDRHPSHF PATLRAQIYS WLSNRPSDME SYIRPGCVVL SLYASMSSAA WEKLEENFLQ  540
HVHSLIQNSD SDFWRNGRFL VHSGSQLASH KDGKVRICKP WRTWKSPELI SVSPLAIVSG  600
QETSISLKGR NLSTPGTKIH CTGTGSYSSA EVIRSSYPGV MYDKIKLSGF KVQDVSPGVV  660
GRFFIEIENG FKGNSFPVII ADETICKELR SLESEFDEEE KMCDAISEDH EHHFGRPRSR  720
EEALHFLNEL GWLFQRERFS YVHEVPSYSL DRFKFILTFA VERNCCMLVK TLLDVLVDKH  780
MQGEWLSTGP VEMLNASQLL NRAVKRKYTG MVDLLIHYSI PNKNSTSRKY VFPPNLEGPA  840
GITPLHLAAC TSGSESVVDS LISDPQEIGL LCWDILVDAN GQTPHAYAMM RNNNSYNALA  900
DRKRAARRRP EISVTIEKEI AQSSLRLELQ QEQSNLVKRG QSSCAKCMTA EIRYNRRISG  960
SQAMLHRPFI YSMLAVAAVC VCVCVFFRGR PYVGSVARFS WETLDYGTM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3279162184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G008800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153124.10.0hypothetical protein PHAVU_003G008800g
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLV7C6W90.0V7C6W9_PHAVU; Uncharacterized protein
STRINGXP_007153124.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]