PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G008400.1
Common NamePHAVU_003G008400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 299aa    MW: 33073.3 Da    PI: 7.8622
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G008400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-321972255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtpeLH++Fv a+e LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Phvul.003G008400.1 19 PRLRWTPELHRCFVYAIETLGGHHKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-311573IPR009057Homeodomain-like
PROSITE profilePS512949.9031575IPR017930Myb domain
SuperFamilySSF466892.15E-151773IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-231973IPR006447Myb domain, plants
PfamPF002492.2E-72071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGSCGREGVV RQYIRSKVPR LRWTPELHRC FVYAIETLGG HHKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMKGDSCRQ VTDKTSTQHR KQSFQEHDDE EGDVGFHSCL KSIGKESDSQ  120
SSCSNFSLKR ARIEKTSLFS GFPHCSQRIC EAVPNPYTTF YDYLQSMAEQ KGIKKICAGS  180
ILQTQPLSTT FLPMLPSQES DLLQVAHLND KQPLNEAENS CRVQSEDENM GGCELSLSIS  240
LPQPHPSSQK SNASSVSSIS EAFSLCPKFN TTNNNNYMGC SSSSNVPNTV NVDLSLAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G008400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150435e-88AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153120.10.0hypothetical protein PHAVU_003G008400g
TrEMBLV7C4Q10.0V7C4Q1_PHAVU; Uncharacterized protein
STRINGXP_007153120.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-34G2-like family protein