PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G273100.1
Common NamePHAVU_002G273100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NAC
Protein Properties Length: 201aa    MW: 22595.2 Da    PI: 4.7098
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G273100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.47.4e-3391251128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGf F+Ptde+l+ ++L +k++  ++++  +i+++d+  ++Pw+L+ k+ ++ ++ yfFs+++        +nr+t++gyWk+ g +++
  Phvul.002G273100.1   9 LPPGFSFSPTDEQLLLHFLYPKTSLPSHPT--IIPDLDLSLHDPWHLNGKALSSGNQHYFFSRAK--------ENRSTENGYWKEIGVTEA 89 
                         79*********************9999888..8**************977777789999999874........5899************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v+s  +e+vg+kk Lvf  g+ap+g++t+Wvm+e+++
  Phvul.002G273100.1  90 VVS-ASEKVGMKKYLVFNLGEAPQGTETSWVMQEFHI 125
                         ***.9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-393156IPR003441NAC domain
PROSITE profilePS5100538.0159156IPR003441NAC domain
PfamPF023653.1E-2010125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MMASGTLNLP PGFSFSPTDE QLLLHFLYPK TSLPSHPTII PDLDLSLHDP WHLNGKALSS  60
GNQHYFFSRA KENRSTENGY WKEIGVTEAV VSASEKVGMK KYLVFNLGEA PQGTETSWVM  120
QEFHICSSSF TTASTRGRRK SDQCRSKWVL CKAYEKKSSE SEEGVNCYND ENDSGTELSW  180
LDEFYMSLDD DLEEVMSLPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-32716218174NAC domain-containing protein 19
3swm_B4e-32716218174NAC domain-containing protein 19
3swm_C4e-32716218174NAC domain-containing protein 19
3swm_D4e-32716218174NAC domain-containing protein 19
3swp_A4e-32716218174NAC domain-containing protein 19
3swp_B4e-32716218174NAC domain-containing protein 19
3swp_C4e-32716218174NAC domain-containing protein 19
3swp_D4e-32716218174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.002G273100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-101AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159851.11e-149hypothetical protein PHAVU_002G273100g
SwissprotQ8GWK61e-51NC104_ARATH; NAC domain-containing protein 104
TrEMBLV7CRF21e-148V7CRF2_PHAVU; Uncharacterized protein
STRINGXP_007159851.11e-149(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.19e-53xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]