PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G239100.1
Common NamePHAVU_002G239100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 391aa    MW: 44722.7 Da    PI: 9.1636
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G239100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.2e-3182135255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Phvul.002G239100.1  82 PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 135
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.21878138IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-3078136IPR009057Homeodomain-like
SuperFamilySSF466898.24E-1580136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2282137IPR006447Myb domain, plants
PfamPF002492.9E-983134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSDEYDMSDE QVDDSSMGSS QKCSSFDLNE EASSENNSNA NDKIYEEAKD EGTSTNKSSS  60
ITREGNNERR GGVRQYVRSK MPRLRWTPEL HLSFVHAVER LGGQERATPK LVLQLMNVRG  120
LSIAHVKSHL QMYRSKKLDE AGQVLSETYK STHELGRISH MTHPRQHFKM GNGGIILASD  180
YSEHSYFHGL LHPSTLSHPH SKAIDSRHQK WYFNNHQPFR KPSYSSNEVA SAALQPQARS  240
MSSNQMDATS IVPMRPSQFL EGKRWPPLEI MNNHPWKKRL PSNTESQSVL LHQFGTTTPA  300
SLRPSDLNFA NKTRIREHIS NSDEHRSYSN SSKLEFEPPF RIKSNQEKMQ KEKQWMPDLR  360
LSLSQRDGNN DEKTDHCRET QEINTKLSLS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1783137357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1783137357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1783137357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1783137357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1783137458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.002G239100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-134AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159455.10.0hypothetical protein PHAVU_002G239100g
RefseqXP_007159456.10.0hypothetical protein PHAVU_002G239100g
TrEMBLV7CQC10.0V7CQC1_PHAVU; Uncharacterized protein
STRINGXP_007159455.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-37G2-like family protein