PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G170700.1
Common NamePHAVU_002G170700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 342aa    MW: 37911.7 Da    PI: 6.8421
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G170700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-312074155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+WtpeLH+rF ea++qLGG+ekAtPk+++++m+++gLtl+h+kSHLQkYRl
  Phvul.002G170700.1 20 KPRLKWTPELHQRFTEAINQLGGAEKATPKSLMRVMGIPGLTLYHLKSHLQKYRL 74
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-291874IPR009057Homeodomain-like
SuperFamilySSF466894.48E-161975IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-222075IPR006447Myb domain, plants
PfamPF002498.8E-82273IPR001005SANT/Myb domain
PfamPF143795.9E-23118164IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDLQNVQTQS MRLVLSTDAK PRLKWTPELH QRFTEAINQL GGAEKATPKS LMRVMGIPGL  60
TLYHLKSHLQ KYRLGKSPPL ETCSDNNQQG FSEIQSSDGH CSPEISTGTQ NQMNENLKIA  120
EALQMQMEVQ RKLYEQIEVQ RHLQLRIEAQ GKYLQSVLSK AHETLARYSS STTGIELAKS  180
ELSQLVSIMN NACPTSPISE LTETRGLSLS CGERKQDRGT MCSLESSLTS SESSGRTEER  240
QPVDEAEKPQ KTKGISVELP LMEIHSEGKK FKGDTSEGRK RSAATDSNGC CVDQPCGKGC  300
GNKLRKCELS EMLDLNSQYQ RDTDSSVKEI DLNCSSSFWG Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-202076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-202076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-202076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-202076157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-201976158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.002G170700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0981690.0BT098169.1 Soybean clone JCVI-FLGm-12I23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158649.10.0hypothetical protein PHAVU_002G170700g
SwissprotF4I2741e-78PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLV7CMT00.0V7CMT0_PHAVU; Uncharacterized protein
STRINGXP_007158649.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.17e-80G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]