PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G126400.1
Common NamePHAVU_002G126400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Trihelix
Protein Properties Length: 310aa    MW: 36335.8 Da    PI: 8.8171
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G126400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix89.63.4e-2848129186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrergf+rsp+qCk+kw+nl +ryk  ++++ ++    s++cp+f++l+
  Phvul.002G126400.1  48 QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGFRRSPEQCKCKWKNLVNRYKGKETSDPEH----SRQCPFFEELH 129
                         7****************************************************************999986....899******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4E-445107IPR001005SANT/Myb domain
CDDcd122031.39E-2647112No hitNo description
PfamPF138371.5E-2347130No hitNo description
PROSITE profilePS500907.65449105IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MFGGGGEDAL AARLGMVTPS LLNPATPLVM SGEVSAVVRE ERAPAQPQWS QQETREFIAI  60
RAELERDFTA SKRNKTLWEV VSSKMRERGF RRSPEQCKCK WKNLVNRYKG KETSDPEHSR  120
QCPFFEELHA VFTQRAHNMQ RLLLESETRS AQTKKGVKRS SGDRSSEELS EDEDEVEYDS  180
EEEKPSRSNT RKKKVDKVGI DKSSSRAYNS SHAVSSSTSS IQEMLKEFFQ HQLRMEMKWR  240
EMMERRAHER QLFEQEWRQS MEKLERERLI IEQAWREREE QRRMREESRA EKRDALLTTL  300
LNKLINEST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A8e-1549115773DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158125.10.0hypothetical protein PHAVU_002G126400g
TrEMBLV7CJ090.0V7CJ09_PHAVU; Uncharacterized protein
STRINGGLYMA01G35370.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.19e-39Trihelix family protein