PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G116000.1
Common NamePHAVU_002G116000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 333aa    MW: 38227.6 Da    PI: 6.8707
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G116000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.71.7e-26205254352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++isl+dl +yF +pi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  Phvul.002G116000.1 205 AKISLSDLVQYFGMPIVEASRNLKVGLTVLKRKCREFGIPRWPHRKIKSL 254
                         589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.577189274IPR003035RWP-RK domain
PfamPF020421.3E-21207254IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MDFSQTNKTT LLTNLLVFNN TVQPELMRSL HVYRQGDGEE RTVEREFVFS DCGSYVEMQA  60
TPVLRLVKSH VSEVCEGYKN GVWLCILAFH ADNTPQFCRI PPLLLASRNP KLQMIPNLLR  120
DLHMIYKLDR KEEDRHTTLG STGEECQGNS NNFQPSEKVF PVLDQDLNYL PYEEDESELL  180
DNETDVESSP GLPGKKKRAP SDLVAKISLS DLVQYFGMPI VEASRNLKVG LTVLKRKCRE  240
FGIPRWPHRK IKSLDSLIQD LQEEAQNQEL ENMEAAMAVA KRQKMLESEK ENIEKKPFMD  300
IQSETKRFRQ DVFKRRHRAR AVGKQNPTVS NT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.002G116000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0903770.0BT090377.1 Soybean clone JCVI-FLGm-4G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157999.10.0hypothetical protein PHAVU_002G116000g
TrEMBLV7CKW10.0V7CKW1_PHAVU; Uncharacterized protein
STRINGXP_007157999.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-77RWP-RK domain-containing protein