PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G112000.1
Common NamePHAVU_002G112000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GATA
Protein Properties Length: 320aa    MW: 35434.7 Da    PI: 6.2448
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G112000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.73.9e-19236270135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  Phvul.002G112000.1 236 CSHCGVQKTPQWRTGPLGPKTLCNACGVRFKSGRL 270
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.2E-811314IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.648230266IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-16230284IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.09E-14232292No hitNo description
Gene3DG3DSA:3.30.50.101.3E-14234268IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.06E-14235283No hitNo description
PfamPF003206.9E-17236270IPR000679Zinc finger, GATA-type
PROSITE patternPS003440236261IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MECMEAALKS NFRKEMTVEL SPETFMEEFS VQNGTTCDDF FVDDLLDFSH VEEEPEQQKE  60
QDSVCLSLQK ENPSQEPYAF KPDYSSVPTT ELSVLADDVA DFEWLSHFVE ESFSEFSAAL  120
PTVTESNPTG LAAKEPKPEL ESPVFTFKTP VQTKARSKRS RNGVRVWPLG SPSFTESSSS  180
STTTTSSSSS SSPSSPLLIY TNIPRSLDHV CSEPKPNKPK KKHSSDSVGT LAPRRCSHCG  240
VQKTPQWRTG PLGPKTLCNA CGVRFKSGRL LPEYRPACSP TFSSELHSNH HRKVLEMRHK  300
KEMVTGTENG FTPAPVPKF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157952.10.0hypothetical protein PHAVU_002G112000g
SwissprotQ9FH576e-74GATA5_ARATH; GATA transcription factor 5
TrEMBLV7CM050.0V7CM05_PHAVU; Uncharacterized protein
STRINGGLYMA01G37450.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.27e-44GATA transcription factor 5