PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G008600.1
Common NamePHAVU_002G008600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 293aa    MW: 32792.1 Da    PI: 8.4927
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G008600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox598.1e-19147201256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +k+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Phvul.002G008600.1 147 KKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 201
                         678899***********************************************98 PP

2HD-ZIP_I/II124.74.4e-40147236191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Phvul.002G008600.1 147 KKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELK-AL 236
                         59*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.556143203IPR001356Homeobox domain
SuperFamilySSF466891.67E-18144211IPR009057Homeodomain-like
SMARTSM003891.3E-15145207IPR001356Homeobox domain
PfamPF000463.2E-16147201IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-17147201IPR009057Homeodomain-like
CDDcd000869.58E-17147204No hitNo description
PROSITE patternPS000270178201IPR017970Homeobox, conserved site
SMARTSM003401.2E-24203246IPR003106Leucine zipper, homeobox-associated
PfamPF021839.4E-10203237IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGFDHDANTS GLHLVLGLSL TATTTPSTKP RDHHHHHLCV IKPTPTKPYS PNEPSLTLGL  60
SGESCHLAKQ VPRNNNVANN NSKVYCEDPL DMSRQTSPHS VVSSFSTGRV VKRERDLSFE  120
EVEAEAEAEE RVSSRLSDEE EDGSNAKKKL RLTKEQSALL EESFKQHSTL NPKQKQALAR  180
QLNLRPRQVE VWFQNRRART KLKQTEVDCE FLKKCCETLT DENRRLKKEL QELKALKLTQ  240
PLYMPMPAAT LTMCPSCERL GGVSDNASNK SPFSMAPKPH FYNPFANPSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.002G008600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0992290.0BT099229.1 Soybean clone JCVI-FLGm-13J3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156684.10.0hypothetical protein PHAVU_002G008600g
SwissprotP466044e-94HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLV7CH710.0V7CH71_PHAVU; Uncharacterized protein
STRINGXP_007156684.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-82HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]