PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G245800.1
Common NamePHAVU_001G245800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 182aa    MW: 20322.3 Da    PI: 6.6496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G245800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.74.9e-44221211100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+
  Phvul.001G245800.1  22 PCASCKLLRRRCTKDCIFAPYFPSNDPQKFALVHKVFGASNVSKMLQELPIQQRADAVSSLVYEAHARVRDPVYGCVGAISYLQNQVSELQ 112
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Phvul.001G245800.1 113 MQLAVAQAE 121
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.75721122IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4322119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MLLSFYSQTK QGICNQMAGN SPCASCKLLR RRCTKDCIFA PYFPSNDPQK FALVHKVFGA  60
SNVSKMLQEL PIQQRADAVS SLVYEAHARV RDPVYGCVGA ISYLQNQVSE LQMQLAVAQA  120
EILCIQMQQE PVMPNPEMEN PDHKSYLLHN ELPQFLNYAS SSNVIYDAVT RESIYGHDLV  180
S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-170AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163576.11e-134hypothetical protein PHAVU_001G245800g
SwissprotQ8LBW32e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLV7D2111e-134V7D211_PHAVU; Uncharacterized protein
STRINGGLYMA18G02780.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-68LBD family protein