PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G227900.1
Common NamePHAVU_001G227900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 483aa    MW: 51726.9 Da    PI: 8.2189
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G227900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32293346255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Phvul.001G227900.1 293 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 346
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15290346IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28291346IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23293346IPR006447Myb domain, plants
PfamPF002499.1E-7294345IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MPLEGIFIEP TSTSTPDLSL HISPPSTSSS SSLICNNTTS GGATHYEAHN STSANFASPA  60
HTELSLGRNF SGGGRGGIQE RPPHNSNPYY QTQQAHFHHL QNHSSTGSAS KAATTTSTTN  120
HLAHINYGVS LLDVSSEGLR PIKGIPVYHN RSFPFLPMEH SGDKDHHAKM CLYHHMPTYP  180
SLSSSCSPLC SSSSSFTSSP TPYFAAAAGS PDPMSYLSSG GTTAAAAAAY RAATATRFNG  240
ISGESFKSHH PLHQHHSSSH YGVGLGGSHE ASSGLMRSRF LPKLPTKRSM RAPRMRWTST  300
LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAAASSGL  360
SDGSGEDDMS PMGSSGGMRQ FSDQRSLSDR AVQQDMDYSS ANTLWSNSSS NREAWPQNSS  420
NDINGFRPPI FQSQQISGGH QIQDCDSSQL KNSLSGSSNL ECKNPSLEFT LGRPDWNGKG  480
QA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-16294348357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16294348357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16294348357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16294348357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.001G227900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163357.10.0hypothetical protein PHAVU_001G227900g
TrEMBLV7D2A60.0V7D2A6_PHAVU; Uncharacterized protein
STRINGXP_007163357.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-55G2-like family protein