PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G202000.1
Common NamePHAVU_001G202000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ARF
Protein Properties Length: 668aa    MW: 74519.9 Da    PI: 6.8378
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G202000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B383.32.2e-26132233199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f kvltpsd++++g +++pk++a+e+         + +  +++  +d++g +W +++iyr++++r++lt+GW+ Fv+a++L +gD+++F  
  Phvul.001G202000.1 132 FSKVLTPSDTSTHGGFSIPKRHADECfrpldmtH-Q-TPAQEILAKDLRGFEWHFRHIYRGQPKRHLLTSGWSTFVNAKKLVAGDSCIFV- 219
                         88****************************9742.3.33459************************************************. PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                          + +++e +v+++r+
  Phvul.001G202000.1 220 -SGESGEVRVGIRRA 233
                         .449999******97 PP

2Auxin_resp83.73.9e-28260341183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st+s F+v+Y+P++ + eF++++ek++k++   +s+G R++m+ + e+s + r++Gt++g++ +d++rWp+S+Wr+Lk
  Phvul.001G202000.1 260 ASHAVSTGSLFTVYYHPWTNPFEFIIPLEKYLKSTVPDYSIGARVQMQCDVEESLR-RYAGTIIGTEVIDSIRWPGSEWRCLK 341
                         789*************************************************9865.67**********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-38127242IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-34127263IPR015300DNA-binding pseudobarrel domain
CDDcd100172.55E-22131232No hitNo description
PfamPF023622.9E-24132233IPR003340B3 DNA binding domain
PROSITE profilePS5086313.606132234IPR003340B3 DNA binding domain
SMARTSM010194.1E-24132234IPR003340B3 DNA binding domain
PfamPF065071.5E-27260341IPR010525Auxin response factor
PROSITE profilePS5174517.206568651IPR000270PB1 domain
SuperFamilySSF542779.12E-6572643No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MRRRREMEPE PRDGLPRNRG PGDDLYTELW RACAGYSVHV PRVGELVFYF PQGHLEQVAA  60
FTQHQQDGHM EIPASGLPSK ILCRVVYVQL QAEIYTDEVF AQVTLVPEAK QNDFDLENED  120
NHVPLRTATY SFSKVLTPSD TSTHGGFSIP KRHADECFRP LDMTHQTPAQ EILAKDLRGF  180
EWHFRHIYRG QPKRHLLTSG WSTFVNAKKL VAGDSCIFVS GESGEVRVGI RRANRHPSNA  240
SLSSSLISGH SMQLGILASA SHAVSTGSLF TVYYHPWTNP FEFIIPLEKY LKSTVPDYSI  300
GARVQMQCDV EESLRRYAGT IIGTEVIDSI RWPGSEWRCL KVQWDAAVDA FMHPERVCPW  360
WIEPLESATE KHFPVLPNPK RPHLLNQHPL PGLSVFGMND AGQSSARAAS QTQRTDRDLQ  420
GQDYSGLSTS WPLQRPSSSD VINPSKFSIS GSQFGKENLN QLPFHMQDIL HKSLGRSTSL  480
AHEDLSISSS NLGSICSDSL GWPPYESRNE NDAPFGQLGS CSRYKLFGVS LIDRQPELPS  540
SQPSSLRSTP PMSVTSGKTC QKCRSVNRSC TKVIKLGTAL GRAVDLSRFR GYDELIAELD  600
SMFDFGGGLV NGSSGWHVTC IDDDGDMMFL RDYPWQDFQC VVQKMIICQK DGINSLNPRS  660
SADPPSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1192337017360Auxin response factor 1
4ldw_A1e-1192337017360Auxin response factor 1
4ldv_A1e-1192337017360Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-145AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163052.10.0hypothetical protein PHAVU_001G202000g
TrEMBLV7D1H20.0V7D1H2_PHAVU; Auxin response factor
STRINGGLYMA19G39340.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131052329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-122auxin response factor 2