PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G143500.1
Common NamePHAVU_001G143500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 338aa    MW: 37706 Da    PI: 8.4329
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G143500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.39.3e-17183237256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++k+q   Le+ F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Phvul.001G143500.1 183 RKKLRLSKTQSAFLEDSFKEHTTLNPKQKLVLAKELNLRPRQVEVWFQNRRARTK 237
                         778899***********************************************98 PP

2HD-ZIP_I/II124.93.7e-40183272191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk q+++LE+sF+e+++L+p++K  la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Phvul.001G143500.1 183 RKKLRLSKTQSAFLEDSFKEHTTLNPKQKLVLAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENKRLQKELQELR-AL 272
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-17176240IPR009057Homeodomain-like
PROSITE profilePS5007116.422179239IPR001356Homeobox domain
SMARTSM003891.6E-14181243IPR001356Homeobox domain
CDDcd000865.06E-15183240No hitNo description
PfamPF000462.9E-14183237IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-16183237IPR009057Homeodomain-like
PROSITE patternPS000270214237IPR017970Homeobox, conserved site
CDDcd146860.001230271No hitNo description
PfamPF021837.9E-11239273IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-22239282IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MNYVDYKKQC FEARPCFIAS SKGKKKKNET VVSHSVDSCT ILVCAFSHSQ FHLKTLISIH  60
SSYFLKPHNL FPLPDMELAL SLGHTDNASL GFSIPTPSSD PPLHLHHLLP STPVLPSPRL  120
PIPWLSHALG MEEIPVRTLD DTDDAAAVSS PNSAVSSFQM DFCRNNRKFS EGDSEEDENG  180
TARKKLRLSK TQSAFLEDSF KEHTTLNPKQ KLVLAKELNL RPRQVEVWFQ NRRARTKLKQ  240
TEVDCEYLKR CCESLTEENK RLQKELQELR ALKTCEPFFK QLPATTLTMC PSCERVATTT  300
STSAAATNKG GVSRDKPRIL SSPPAAGPHG SSDCFFI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231239RRARTKLKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.001G143500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311631e-156KT031163.1 Glycine max clone HN_CCL_195 homeodomain/HOMEOBOX transcription factor (Glyma03g30200.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162339.10.0hypothetical protein PHAVU_001G143500g
TrEMBLV7CY770.0V7CY77_PHAVU; Uncharacterized protein
STRINGXP_007162339.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-72homeobox from Arabidopsis thaliana