PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G141700.1
Common NamePHAVU_001G141700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 372aa    MW: 42181.6 Da    PI: 7.7701
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G141700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.92.2e-23233287155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k r++Wt++LHe F+  v++LGG+ekA Pk+il+ mk + L+++hvkSHLQk R+
  Phvul.001G141700.1 233 KRRVKWTNDLHEPFMMIVNSLGGPEKAKPKAILDKMKSDLLSISHVKSHLQKCRS 287
                         68**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-20231288IPR009057Homeodomain-like
SuperFamilySSF466891.97E-10232288IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-19233287IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MYQYSSQMYG TEWESYMGIS NLGKVVGSEQ VSVVDPKNSP FNIVTNPFQI QTPQGFCASA  60
TKGLLSFQAQ QHGHHQHQIE VPSWSFEFPK TTTTDSHMLN IRQASGDNFA TITTKQDPPS  120
SQFTSSLCPV AESFLSSSTD ADCPSSSEKY CKITSYSEKY SSMQPDGMPY YDHCSQEEDK  180
LLRDDAATHE RPLEISFQRN QLESCTKPHK QAPHRLCGVT CVTSSNSVSR RGKRRVKWTN  240
DLHEPFMMIV NSLGGPEKAK PKAILDKMKS DLLSISHVKS HLQKCRSTIH VHKTLQEKSK  300
EGQGMDGVAE LQVKIHMQIE ESRQLQLEVR RNICQQLEMQ RNLQMLIQQQ SQQLKVMLDY  360
QKKKNQTEED P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14232287156Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.001G141700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-117AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162314.10.0hypothetical protein PHAVU_001G141700g
TrEMBLV7CY540.0V7CY54_PHAVU; Uncharacterized protein
STRINGXP_007162314.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144901016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.22e-24G2-like family protein