PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G141600.1
Common NamePHAVU_001G141600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 420aa    MW: 46639.4 Da    PI: 7.6346
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G141600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.91.4e-30245299155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rW+++LHe+Fve+v++LGGse+AtPk+il++m+ +gLt+ hvkSHLQkYR+
  Phvul.001G141600.1 245 KTRIRWAKDLHEKFVECVNRLGGSEHATPKAILKMMDTDGLTIFHVKSHLQKYRI 299
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15243299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-26243300IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-22245300IPR006447Myb domain, plants
PfamPF002492.4E-7249298IPR001005SANT/Myb domain
PfamPF143799.2E-20330376IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MNENKVHWGG LIQQTHGLSG DFNSEFGNHY CQYFDIRQAW NMGPLAMVGG EATDQLPNIG  60
HVKSSGTIIS RFESPASAFY ATENCMGFAE YDCQVGIQPQ LSKINDLEFP LYQSPRENLF  120
LDSANQPDSS YDLSNTLQSI VKSQLNNNQC RVSPESSSKI SCGNFPTTKF LPIEQQKLFI  180
DGVIRGSSFP NKGSQDHMVA CGSFNLPVAH LRFSSEIEKL SPTLSAASVS TVGNSASNGA  240
VVSSKTRIRW AKDLHEKFVE CVNRLGGSEH ATPKAILKMM DTDGLTIFHV KSHLQKYRIA  300
KFIPEPSQGK SDKRTHTKNL HHLDVKTGLQ IREALKLQLD AQRCLHEQLE VQRKLQLRIE  360
EQGRQLKKMF DQQQKTSNNL LYAHDSATDE TTITHKDGEV SVSEGANNSF FTSKASPSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-22245302259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.001G141600.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312050.0KT031205.1 Glycine max clone HN_CCL_162 MYB/HD-like transcription factor (Glyma19g32850.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162313.10.0hypothetical protein PHAVU_001G141600g
TrEMBLV7CVV70.0V7CVV7_PHAVU; Uncharacterized protein
STRINGXP_007162313.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-68G2-like family protein