PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J773300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 461aa    MW: 52866.9 Da    PI: 7.8568
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J773300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS44.82.1e-141142122118
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cA+av+++++  a +lL++++++as +gd++qR+a+ + + L a                  s    +e l+a++l++ ++ + k+
  Pavir.J773300.1.p 114 RTLLISCAHAVATNNHMGACELLKKIKQHASTTGDATQRVAHQLWQVLMAERP---------------S---IVEFLKAYRLYFAACSFNKV 187
                        789***************************************98877654322...............2...899***************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfd 118
                        +      +Il+a+ g++++H++D++
  Pavir.J773300.1.p 188 ALSFSTMTILQAMVGKSKLHVVDYE 212
                        ***********************85 PP

2GRAS175.93.1e-54216452140373
               GRAS 140 pslRiTgvgspesg..skeeleetgerLakfAeelgv.pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erde 226
                        p+++iT++g+p+ +   +e+ ee+g rL+k A+e+g+ +f+f + + k++ed+ +e+L+++ +E+l+Vn  ++  +l+desv  +   +rd+
  Pavir.J773300.1.p 216 PEVKITAIGPPKLKscPSERFEELGCRLSKWANEFGLaSFKFYT-IIKKWEDVCIEDLNTDIDEVLVVNDLFSFSTLMDESVFFDRqsPRDT 306
                        99********9999999*******************957*****.79**********************************96554449*** PP

               GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                        vL+ +k+++P+v++ +  ++++ ++sFl+rf e ++yy+alfd l+a++pres+ r+++E+++lg  + n++aceg + ++r e++++W+ r
  Pavir.J773300.1.p 307 VLSNIKKMRPDVFIQSIWNCSC-GSSFLTRFREVMSYYMALFDILDATMPRESKSRVVLEQFVLGYPALNIIACEGPDLVQRPEKYRQWQVR 397
                        **********************.679****************************************************************** PP

               GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         ++aG++++pl++++++ +k  ++k++ + + + e+ ++l++gW++r L++ S W
  Pavir.J773300.1.p 398 NQRAGLRQLPLKSRIVEVVKDTVQKHHHKDFLICEDGQWLLQGWMGRVLFAHSTW 452
                        ***************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.11187433IPR005202Transcription factor GRAS
PfamPF035147.3E-12114212IPR005202Transcription factor GRAS
PfamPF035141.1E-51216452IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEEANMLLPK DNKFRGDVQV NQLVRETSNH TGNKKRYNTD NLMEEETRTS KAAKMIKDAE  60
ENCANEMLDE MMLHAYETCI RGMEELRVSM DNKVEKENRK RRNKATKGDA VDIRTLLISC  120
AHAVATNNHM GACELLKKIK QHASTTGDAT QRVAHQLWQV LMAERPSIVE FLKAYRLYFA  180
ACSFNKVALS FSTMTILQAM VGKSKLHVVD YEGVLPEVKI TAIGPPKLKS CPSERFEELG  240
CRLSKWANEF GLASFKFYTI IKKWEDVCIE DLNTDIDEVL VVNDLFSFST LMDESVFFDR  300
QSPRDTVLSN IKKMRPDVFI QSIWNCSCGS SFLTRFREVM SYYMALFDIL DATMPRESKS  360
RVVLEQFVLG YPALNIIACE GPDLVQRPEK YRQWQVRNQR AGLRQLPLKS RIVEVVKDTV  420
QKHHHKDFLI CEDGQWLLQG WMGRVLFAHS TWVAEGTSSQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-211174528374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135140LKKIKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.12e-86GRAS family protein