PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J771700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 419aa    MW: 44265 Da    PI: 9.2028
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J771700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.23.5e-49471722128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                        +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + 
  Pavir.J771700.1.p  47 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELIAFLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGSRPNRVTASGYWKATGADRMIR 137
                        79***************************.89***************7767789************************************** PP

                NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Pavir.J771700.1.p 138 GENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 172
                        *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-5645196IPR003441NAC domain
PROSITE profilePS5100554.93946196IPR003441NAC domain
PfamPF023651.5E-2448172IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MSKDLEDGQG AVDNVVAAAA GGGEGSSEAA GGGGGGGGDA HDNDVVMPGF RFHPTEEELI  60
EFYLRRKVEG KRFNVELIAF LDLYRFDPWE LPAMAVMGGK EWFFYVPRDR KYRNGSRPNR  120
VTASGYWKAT GADRMIRGEN NRPIGLKKTL VFYSGKAPKG VRSSWIMNEY RLPPPATDAD  180
PLTPKSEISL CRVYKRSGID DGHGQSSSST QASSGRRISS RTSVPTGRHG SSPSSTPLSP  240
TQQLSSFHLL QGECSSASPP APIMDQVVTL QTAPPLLPPP RPPCTYAPAA TIRSTAAVAP  300
AQRAQGAAAI IPSSTYSRLN MAAAGAAPMA GSSRPIDELS TLVGPGPSQA YANLAAVTGS  360
HFLPLMPAPP PPMPQMTPLG ALPMVAPPPP SVTDKLSWDW NPPVPDTTAR DYNASGFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-554819719166NO APICAL MERISTEM PROTEIN
1ut4_B1e-554819719166NO APICAL MERISTEM PROTEIN
1ut7_A1e-554819719166NO APICAL MERISTEM PROTEIN
1ut7_B1e-554819719166NO APICAL MERISTEM PROTEIN
3swm_A1e-554819722169NAC domain-containing protein 19
3swm_B1e-554819722169NAC domain-containing protein 19
3swm_C1e-554819722169NAC domain-containing protein 19
3swm_D1e-554819722169NAC domain-containing protein 19
3swp_A1e-554819722169NAC domain-containing protein 19
3swp_B1e-554819722169NAC domain-containing protein 19
3swp_C1e-554819722169NAC domain-containing protein 19
3swp_D1e-554819722169NAC domain-containing protein 19
4dul_A1e-554819719166NAC domain-containing protein 19
4dul_B1e-554819719166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587620.0HQ858762.1 Zea mays clone UT1609 NAC transcription factor mRNA, partial cds.
GenBankBT0604780.0BT060478.1 Zea mays full-length cDNA clone ZM_BFb0004F04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK3Z6L90.0K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.28e-88NAC domain containing protein 35