PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J683200.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 481aa    MW: 53515.4 Da    PI: 6.1593
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J683200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28161211252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Pavir.J683200.3.p 161 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 211
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.600.001148201IPR009057Homeodomain-like
PROSITE profilePS5151917.006150231IPR003035RWP-RK domain
PfamPF020421.9E-26163211IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.5E-24382463No hitNo description
SuperFamilySSF542777.01E-22382462No hitNo description
PROSITE profilePS5174521.818382465IPR000270PB1 domain
SMARTSM006662.5E-22382465IPR000270PB1 domain
CDDcd064071.94E-41383463No hitNo description
PfamPF005649.6E-16383464IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MLNSLSITIQ QTCYTLRVVS LKELVDEGSF ETSTLTPAKF YDKPIHENLD EVCSNIEGPA  60
RTTSLETSEE VSSWIASLVD AQSKGAKEMF GDLPFGFSKQ EDEGFSVTAG WHTSPVLGPK  120
GSIFSEIKQH EEYEVKEPIC SRGPSPSNMN KTVEKRRTKM EKTVSLEELR KHFAGSLKEA  180
AKNLGVCPTT LKRICRQHGI NRWPSRKIKK VGHSLKKLQM VIDSVHGAEG TVQLSSLYEN  240
FTKTTWSERE LQGDGTYPLS EQKDHLEPSV PDRQCEGRFT SHTSGSNSLS PSCSQSSNSS  300
HGCSSGSKSQ QDGNAPQLAV KQEVLMEENQ SSTLLKAASH AELQMFTEER PVVLPRSQSQ  360
MLVSEQKPEE NMSGMQKSKP VSLKIKAMYG EERCIFRLQP SWGFEKLKEE IVKRFSIAQE  420
MYVDLKYLDD ESEWVLLTCD ADLLECIDVY KSSNAQTVRI LVNVNVQPVL GPSFGQTGLP  480
*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.J683200.3.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797092.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A3L6TQF20.0A0A3L6TQF2_PANMI; Protein NLP1-like isoform X2
STRINGPavir.J25840.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.18e-79Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]