PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J683200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 674aa    MW: 75165.1 Da    PI: 6.467
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J683200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.7e-28354404252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Pavir.J683200.2.p 354 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 404
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006343424IPR003035RWP-RK domain
PfamPF020423.0E-26356404IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2404.2E-24575656No hitNo description
SuperFamilySSF542771.18E-21575655No hitNo description
PROSITE profilePS5174521.818575658IPR000270PB1 domain
SMARTSM006662.5E-22575658IPR000270PB1 domain
CDDcd064072.07E-40576656No hitNo description
PfamPF005641.6E-15576657IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MTTQKINYNA EVENICSALK EVDLRSTDVS SDPHGNVADI SYRAVVPEII DVLRAVCERH  60
KLPLAQTWIP CICQAKRGSR HSDEKLKYCV SPVDEACYVR DQAVKGFHQA CSDHHLFRGE  120
GVVGRAFGTN EPCFSPDITA YSKVQYPLSH HAKLFSLRAA VAIRLRSIRT GTLDYVLEFF  180
LPVDCIESEE QRAMLNSLSI TIQQTCYTLR VVSLKELVDE GSFETSTLTP AKFYDKPIHE  240
NLDEVCSNIE GPARTTSLET SEEVSSWIAS LVDAQSKGAK EMFGDLPFGF SKQEDEGFSV  300
TAGWHTSPVL GPKGSIFSEI KQHEEYEVKE PICSRGPSPS NMNKTVEKRR TKMEKTVSLE  360
ELRKHFAGSL KEAAKNLGVC PTTLKRICRQ HGINRWPSRK IKKVGHSLKK LQMVIDSVHG  420
AEGTVQLSSL YENFTKTTWS ERELQGDGTY PLSEQKDHLE PSVPDRQCEG RFTSHTSGSN  480
SLSPSCSQSS NSSHGCSSGS KSQQDGNAPQ LAVKQEVLME ENQSSTLLKA ASHAELQMFT  540
EERPVVLPRS QSQMLVSEQK PEENMSGMQK SKPVSLKIKA MYGEERCIFR LQPSWGFEKL  600
KEEIVKRFSI AQEMYVDLKY LDDESEWVLL TCDADLLECI DVYKSSNAQT VRILVNVNVQ  660
PVLGPSFGQT GLP*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.J683200.2.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797092.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A3L6TQF20.0A0A3L6TQF2_PANMI; Protein NLP1-like isoform X2
STRINGPavir.J25840.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-148Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]