PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J637000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 445aa    MW: 49923.2 Da    PI: 7.9082
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J637000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.71.7e-102684382373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+av++++ + a +lL ++++++sp+gd++qRla++f+e+L+arla+s+s+ly++  +++ +   ++e l+a  l+  ++ +  +
  Pavir.J637000.1.p  68 STLLIHCAQAVATDNRRGAAELLRQIRQHSSPRGDATQRLAHVFAEGLEARLAGSGSQLYASTVAERVP---VTEYLKACWLYLAACCFEMV 156
                        579*********************************************************988888888...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        ++     aI +a++g +++Hi+D+++s+G+QWp+Ll+ La+R++gpp++RiTg++ p++g   + ++e+tg+rL++ A+++gv f+f+  +a
  Pavir.J637000.1.p 157 AFKFSIAAICNAAAGRKKLHIVDYGVSYGFQWPTLLRCLANREGGPPEVRITGIDLPQPGfrPAAQIEATGRRLSNCARQFGVAFKFRG-IA 247
                        ***********************************************************9*9***************************.79 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         ++e++  ++L+++++E+l+Vn+v   ++l+de ++++s  +rd vL  +++++P+++++   ++  +++ Fl+rf eal yysa+fd+l+a
  Pavir.J637000.1.p 248 AKWETIGADDLDIDRDEVLIVNSVR-FQNLMDEGADIDSpsPRDIVLGNIRKMRPDMFILFTTNVLSGASFFLTRFREALFYYSAMFDMLDA 338
                        9*********************997.8999999999988779************************************************** PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                        ++pr+s++r  vEr l+++ + n+vaceg++r+er et+++W++r ++aG+k++pl+ +++ +++ ++r+ + + + ++ ++++l+ gWk+r
  Pavir.J637000.1.p 339 TAPRDSHQRLLVERGLFRPCALNAVACEGSDRVERPETYKQWQARSQRAGLKQLPLDPDIVRDVREMVREQYHKDFAIDVDHHWLLEGWKGR 430
                        ************************************************************************888***************** PP

               GRAS 366 pLvsvSaW 373
                         L+++S W
  Pavir.J637000.1.p 431 VLYAMSTW 438
                        ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.70341419IPR005202Transcription factor GRAS
PfamPF035145.7E-10068438IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MVPEPEETGE VVDEMIVNAY DLCLKEMESL RITMGSSEDT KKKKEKKKKG MKGKGKGSRS  60
RNEAVDLSTL LIHCAQAVAT DNRRGAAELL RQIRQHSSPR GDATQRLAHV FAEGLEARLA  120
GSGSQLYAST VAERVPVTEY LKACWLYLAA CCFEMVAFKF SIAAICNAAA GRKKLHIVDY  180
GVSYGFQWPT LLRCLANREG GPPEVRITGI DLPQPGFRPA AQIEATGRRL SNCARQFGVA  240
FKFRGIAAKW ETIGADDLDI DRDEVLIVNS VRFQNLMDEG ADIDSPSPRD IVLGNIRKMR  300
PDMFILFTTN VLSGASFFLT RFREALFYYS AMFDMLDATA PRDSHQRLLV ERGLFRPCAL  360
NAVACEGSDR VERPETYKQW QARSQRAGLK QLPLDPDIVR DVREMVREQY HKDFAIDVDH  420
HWLLEGWKGR VLYAMSTWVA DDAM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-43714388374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-136GRAS family protein