PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J611700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 402aa    MW: 45479.4 Da    PI: 9.3393
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J611700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.51.1e-99163971373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.....ppsetseknsseelaalklfsev 87 
                        l++lL++cAeavs+g+   a++lL ++++++sp+gd+ qRla++f+++L+ rla+++++  +al     +p + ++ +++  l+a++l+++v
  Pavir.J611700.1.p  16 LRTLLIHCAEAVSAGNRLGATELLRQIKKRSSPTGDAWQRLAHCFAKGLELRLAGTGTGKQHALlmgmaKPPKRTSAEEALDLKAYHLYVQV 107
                        6789**************************************************98777666653221133333333477788999****** PP

               GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                        + ++  ++    +aI +a++g ++vHi+D++  +G+QWp Ll aLa R++gpp++RiT+++ p++g   + + +etg+r ++fA++ gvpf+
  Pavir.J611700.1.p 108 CSFHMAAFKFSQSAIWKATAGRKKVHIVDYGEHHGFQWPLLLYALAHREGGPPEVRITTIVYPQPGfrPAAQSQETGRRFTDFARQRGVPFK 199
                        *****************************************************************9999*********************** PP

               GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                        f+v+va r+e++  ++L+++p+E+l+Vn  ++  rl+de v++es  +rd vL  +++++P+v++++ ++++++++ F+ rf eal yysa+
  Pavir.J611700.1.p 200 FRVIVAARWETVCADDLDIQPDEVLVVNGLFHFGRLMDEGVDVESpsPRDVVLANIRNMRPDVFILCIENSSYGAPFFVLRFREALFYYSAM 291
                        ***************************************999999889******************************************** PP

               GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                        fd+++a+ pr+s er++vE+ellgr + n++aceg+er+er et+++W+ r  +aG++++pl+ +++k  +  +++ + + + ++ ++++l+
  Pavir.J611700.1.p 292 FDMMDATTPRDSAERMVVEQELLGRCALNAIACEGSERVERPETYKQWQVRCCRAGLRQLPLNPSTVKYLSDKVKNGYHKDFVIHVDQKWLL 383
                        ***************************************************************************999888*********** PP

               GRAS 360 lgWkdrpLvsvSaW 373
                        +g k+r L+++S W
  Pavir.J611700.1.p 384 QGCKGRILYAMSTW 397
                        ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.1281378IPR005202Transcription factor GRAS
PfamPF035143.7E-9716397IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MERQRRRRSG NEAVDLRTLL IHCAEAVSAG NRLGATELLR QIKKRSSPTG DAWQRLAHCF  60
AKGLELRLAG TGTGKQHALL MGMAKPPKRT SAEEALDLKA YHLYVQVCSF HMAAFKFSQS  120
AIWKATAGRK KVHIVDYGEH HGFQWPLLLY ALAHREGGPP EVRITTIVYP QPGFRPAAQS  180
QETGRRFTDF ARQRGVPFKF RVIVAARWET VCADDLDIQP DEVLVVNGLF HFGRLMDEGV  240
DVESPSPRDV VLANIRNMRP DVFILCIENS SYGAPFFVLR FREALFYYSA MFDMMDATTP  300
RDSAERMVVE QELLGRCALN AIACEGSERV ERPETYKQWQ VRCCRAGLRQ LPLNPSTVKY  360
LSDKVKNGYH KDFVIHVDQK WLLQGCKGRI LYAMSTWAAD S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-39203978374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001145990.10.0uncharacterized protein LOC100279519
TrEMBLC0PG950.0C0PG95_MAIZE; Uncharacterized protein
STRINGGRMZM2G018254_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-128GRAS family protein