PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J565400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 378aa    MW: 39171.5 Da    PI: 9.0113
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J565400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.24.3e-4264139176
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                        +CqvegC +dls ak yh rhkvC++h+k+p v+v+g+eqrfCqqCsrfh+l efD++krsCrrrL +hnerrrk+
  Pavir.J565400.1.p  64 RCQVEGCGVDLSGAKPYHCRHKVCSMHTKTPRVVVAGMEQRFCQQCSRFHQLPEFDQGKRSCRRRLIGHNERRRKP 139
                        6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-3460126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.39462139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-4063143IPR004333Transcription factor, SBP-box
PfamPF031103.2E-3265138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
METGGSGSNG GGGSDDVRGL KFGKKIYFEQ DAAAAAGGSG AAAAGGRKGK GVAAGPPHAA  60
APPRCQVEGC GVDLSGAKPY HCRHKVCSMH TKTPRVVVAG MEQRFCQQCS RFHQLPEFDQ  120
GKRSCRRRLI GHNERRRKPP PGPLTSRYGR LAASFQEPGR FRSFLLDFSY PRVPSCVRDA  180
WPAIQPGGDR VPGTIQWQGN QEAHPHRSTV AGYGNHAYIG HGGSVAGPSV LPAAFELPPG  240
GCVAGVATDS SCALSLLSTT TQPWDSAQSA SHNRSPAMSE ASAFEGTPVA PSVMASSYPA  300
AGAWTGSRGP APDGARSVQH PEDALHLVHP GSVHHGNFSG ELELALQGSG PSNTPHAHHG  360
SSGGTFSHSS NAMNWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29651381184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.J565400.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802689.10.0squamosa promoter-binding-like protein 17
SwissprotA3C0571e-155SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A3L6TDA50.0A0A3L6TDA5_PANMI; Squamosa promoter-binding-like protein 17
STRINGPavir.J11258.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.15e-44squamosa promoter binding protein-like 9