PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J257200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 229aa    MW: 23539.4 Da    PI: 10.6666
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J257200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.56.3e-22181228148
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                        +Cqv++C+adls+ak+yhrrhkvCe+hsk++++lv+ ++qrfCqqCsr
  Pavir.J257200.1.p 181 MCQVDDCRADLSSAKDYHRRHKVCEAHSKTTKALVASQMQRFCQQCSR 228
                        6**********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-23175228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.64179228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.15E-20180228IPR004333Transcription factor, SBP-box
PfamPF031101.4E-15182228IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MQREVGPQVA PPLFMHQIQP LPPHAAAAKK RAHPWPAAVA PARAAAAAGD GNWNPKMWDW  60
DSRALTARPS SDALRLGGGG AQGQQQQQQP QPASAAAKAA EAHRQGNGAL NLQLGLRKDA  120
ATPMDASPPA PMASSPSPPA SAAAGQEPVV RPSKRVRSGS PGSAGGSGGG GGANGAASYP  180
MCQVDDCRAD LSSAKDYHRR HKVCEAHSKT TKALVASQMQ RFCQQCSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A5e-22182228652squamosa promoter-binding protein-like 12
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.J257200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0695685e-44BT069568.2 Zea mays full-length cDNA clone ZM_BFb0168D17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021320166.13e-86squamosa promoter-binding-like protein 15
SwissprotA2YX042e-70SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M82e-70SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLA0A3L6QB904e-93A0A3L6QB90_PANMI; Squamosa promoter-binding-like protein 15
STRINGPavir.Fa00457.1.p1e-154(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.13e-24squamosa promoter binding protein-like 14