PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J062800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 791aa    MW: 86692.4 Da    PI: 6.2458
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J062800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP82.27e-261532678
                       HHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP 26 vhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                       +h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Pavir.J062800.2.p  1 MHAKASTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNRRRRKTRP 53
                       69************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114121.939151IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.7E-15138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.15E-23155IPR004333Transcription factor, SBP-box
PfamPF031102.2E-17150IPR004333Transcription factor, SBP-box
CDDcd002041.49E-9547677No hitNo description
SuperFamilySSF484034.2E-8571677IPR020683Ankyrin repeat-containing domain
SMARTSM002480.34572601IPR002110Ankyrin repeat
Gene3DG3DSA:1.25.40.205.3E-8574676IPR020683Ankyrin repeat-containing domain
SMARTSM00248710618648IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 791 aa     Download sequence    Send to blast
MHAKASTAVV GNTVQRFCQQ CSRFHLLQEF DEGKRSCRRR LAGHNRRRRK TRPDIAIGGT  60
ASIEDKVSNY LLLSLIGICA NLNSDSVQHS NSQELLSTLL KNLGSVAKSL EPKELCKLLE  120
AYQSLQNGSN AGTSGTTNAA EEAAGPSNSK LPFGNGSHRG QASSSVVPVQ SKATVVVTPE  180
PASCKLKDFD LNDTCNDMEG FEDGQEGSPT PAFKAADSPN CASWMQQDST QSPPQTSGNS  240
DSTSTQSLSS SNGDAQCRTD KIVFKLFNKV PSDLPPVLRS QILGWLSSSP TDIESYIRPG  300
CIILTVYLRL VESAWRELSG NMSLHLDKLL NSSTDNFWAS GLVFVMVRQQ LAFMHNGQIM  360
LDRPLAPSSH QYCKILRVRP VAAPYSATIN FRVEGFNLLS TSSRVICSYE GCCIFQEDTD  420
TVADDAEDIE CLSFCCSVPG SRGRGFIEVE DSGFSNGFFP FIIAEKDVCS EVSELESIFE  480
SSSDEYAVVD DNARDQALEF LNELGWLLHR ANRMSKQAET DTPLAAFNMW RFRKLGIFAM  540
EREWCAVVEM LLNFLFIGLV DLGSQSPEEM VLSENLLHAA VRRKSVKMVR FLLRYKPNKN  600
SKGTAQTYLF RPDALGPLTI TPLHIAAATS DAEDVLDALT DDPGLVGISA WSNARDETGF  660
TPEDYARQRG NDAYLNLVHK KIDKHLGKGH VVLGVPSSMC SVIPDGAKPG DVSLEICRPM  720
SASVPRCLLC TQQARVYPNS GARTFLYRPA MLTVMGVAVV CVCVGILLHT FPRVYAAPTF  780
RWELLERGPM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-171503584squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.8350.0callus| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.J062800.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0388520.0BT038852.1 Zea mays full-length cDNA clone ZM_BFb0336G12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025793312.10.0squamosa promoter-binding-like protein 6
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A2S3IGN30.0A0A2S3IGN3_9POAL; Uncharacterized protein
STRINGPavir.J01500.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-179squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]