PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J015600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family BES1
Protein Properties Length: 359aa    MW: 36047.1 Da    PI: 9.993
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J015600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822141.76.7e-4437113379
             DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleea 79 
                          r +t +ErEnn++RERrRR ia+kiy+GLR +Gny lp  +Dnne lkALcreAGw+ve DGttyrkg+kp+  +
  Pavir.J015600.1.p  37 YVRVQTCRERENNRHRERRRRMIASKIYSGLRTHGNYTLPRTCDNNELLKALCREAGWTVELDGTTYRKGCKPPAPP 113
                        57999********************************************************************9444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.8E-4238118IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MNGGGAGGSS GGGGSGTDGV GGRGTREGKG TSRTTGYVRV QTCRERENNR HRERRRRMIA  60
SKIYSGLRTH GNYTLPRTCD NNELLKALCR EAGWTVELDG TTYRKGCKPP APPAADLCFA  120
GIGCGPAPVS PAWSSSQITL GAGSGGVFLH GAGGSNNNGF GGGGWGYAGG GLMAPWLKSL  180
SHSQPGSASA SSSSAPMTPP PQNGSPLAGM LARSAADNPA AGAGAASNVQ PPWATRAGPI  240
HYPSLPFAMP RPNPVVDRRA AAAHPMSKLA GFQMPAAAAS SSSSMAPGPS SLLSLGAGSS  300
SSSRIIHAAG PGGQIISGAQ ASAAAHGVMW EEEVGEKYSD EEALELTLGN ARTRADRA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A5e-2059109392442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B5e-2059109392442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C5e-2059109392442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D5e-2059109392442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.J015600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468545.11e-46protein BZR1 homolog 4
TrEMBLC5WYY13e-45C5WYY1_SORBI; Uncharacterized protein
STRINGPavir.J11404.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1866659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.13e-22BES1/BZR1 homolog 2