PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG757500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 879aa    MW: 97767.6 Da    PI: 5.3056
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG757500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.72.3e-28607657252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Pavir.9NG757500.1.p 607 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 657
                          799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.893591677IPR003035RWP-RK domain
PfamPF020424.1E-26609657IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2405.3E-24777861No hitNo description
SuperFamilySSF542771.69E-21779860No hitNo description
PROSITE profilePS5174521.818780863IPR000270PB1 domain
SMARTSM006663.1E-22780863IPR000270PB1 domain
CDDcd064072.43E-40781861No hitNo description
PfamPF005641.0E-15781862IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 879 aa     Download sequence    Send to blast
MEQPASRKDG DALPGYAVME LEDVAVGDLD LMEELFMAAP GFDFSDFSQP GADAPPGACF  60
SPLFDICSTT TTATPPAPAG EDDRDDPERA DWPEADVAAP PRPAWLFQPG QEVEATVRER  120
LRRALERIAS LSQTQPGELL AQVWVPTLIG DRQVLTTCGQ PFWLDSRNQR LANYRSVSMK  180
YQFSADESAR AELGLPGRVF VGRVPEWTPD VRYFSTEEYP RVRHAQSLDI RGSVALPIFE  240
PRTRACLGVI ELVMTTQKIN YNAEVENICS ALKEVDLRST DVSSDPHANV TDSSYRAVVP  300
EIIDVLRTVC ERHKLPLGQT WIPCICQAKR GSRHSNEKLK YCVSTVDEAC YVRDLAVKGF  360
HQACSDHHLF RGEGVVGRAF GTNEPCFSPD ITAYSKVQYP LSHHAKLFSL RAAVAIRLRS  420
IRTGSLDYVL EFFLPVDCIE SEEQRAMLNS LSITIQQTCY TLRVASLKEL VDEGSFETST  480
LTPAEFYDKP IHENLDDVCR NIEVPARTTS LETSEEVSSW IASLVDAQSK GAKEMFGDLP  540
FGFSKQEDEG FSVTAGWHTS PVLGPKGSIF SGFKQHEEYE VKEPICSRGS SPSNMNKTVE  600
KPRTKMEKTV SLEELRKHFA GSLKEAAKNL GVCPTTLKRI CRQHGINRWP SRKIKKVGHS  660
LKKLQMVIDS VHSAEGTVQL SSLYENFTKT TCQSSNSSHG CSSGSKSQQN GNAPQLAVKQ  720
EVLMEENQSS TLLNAASHAE LLMFTEERPV ALPRSQSQML LSEQKPEENM SGMQKSKTDS  780
LKIKAMYGEE RCIFRLQPSW GFEKLKEEIV KRFSIAQEMY VDLKYLDDES EWVLLTCDAD  840
LLECIDVYKS SSAQTVRILV NVNVQPVLGP SFGQTGLS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG757500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797092.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A3L6TQF20.0A0A3L6TQF2_PANMI; Protein NLP1-like isoform X2
STRINGPavir.Ia04472.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]