PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG683700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 528aa    MW: 60048.3 Da    PI: 9.0686
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG683700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.29.5e-1637119896
                          -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                           d+++++ l++p++f++++ gk   s  ++le+++g  ++v++    + +++vl++GW+ Fv+an+++e+ f++F+++++s+f   v +
  Pavir.9NG683700.1.p  37 MDANSKHSLIMPNRFVKRFAGK--LSGRIKLESPNGTLYNVEV--IERYNKTVLQRGWEAFVDANHIQENNFMLFHHIEKSRF--EVLI 119
                          48889999***********888..6668***************..7777789*************************998998..5544 PP

2B344.92e-142593471299
                          HT.T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
                   B3  12 ks.grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98 
                          +s + lv++k++a +h    +e++ ltl+   ++++W  ++ +r+ ++ y+l++ W +Fv++n+++egD++++  +++ ++f+l+v ++r
  Pavir.9NG683700.1.p 259 SSgSYLVISKEYALAHFP--HETTYLTLQRpGKSKKWHPRFYIRNDRRVYMLRGQWLDFVRDNHVQEGDICLLLPEKTgRKFTLTVYLLR 346
                          443679**********73..45668999995566*******77888888*************************99999*******9998 PP

                          S CS
                   B3  99 k 99 
                          +
  Pavir.9NG683700.1.p 347 A 347
                          6 PP

3B350.73.3e-16437524899
                          -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          s v ++++l +  ++a+++   ++++ + ++ + +g+ W+  +   +++ r +l++GW +Fv +ngL++gD+++F+l++ s+ ++ v+v+
  Pavir.9NG683700.1.p 437 SVVVSKQMLEFGAHYAAAYL--PARK-QTMVLQCNGKIWNTDMV-IRNGHRLFLRGGWPKFVCDNGLRVGDMCLFELKNGSKLTMEVHVI 522
                          34445555555566666662..3343.4566777*********5.56667899************************988*********9 PP

                          -S CS
                   B3  98 rk 99 
                          ++
  Pavir.9NG683700.1.p 523 SR 524
                          87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.44E-2028130IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-1828125IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.61930123IPR003340B3 DNA binding domain
CDDcd100171.55E-1732120No hitNo description
SMARTSM010192.2E-733123IPR003340B3 DNA binding domain
PfamPF023624.5E-1436119IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-18240345IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.65E-19243349IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.5E-8248348IPR003340B3 DNA binding domain
CDDcd100174.02E-19248343No hitNo description
PROSITE profilePS5086311.35249348IPR003340B3 DNA binding domain
PfamPF023624.4E-13250347IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-20421523IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-20422523IPR015300DNA-binding pseudobarrel domain
CDDcd100173.20E-18427523No hitNo description
SMARTSM010193.4E-10430525IPR003340B3 DNA binding domain
PROSITE profilePS5086312.365430525IPR003340B3 DNA binding domain
PfamPF023627.6E-15436524IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MARNGSSRMK KPCDCCKRYL DHLDEKNQPM SYFFRRMDAN SKHSLIMPNR FVKRFAGKLS  60
GRIKLESPNG TLYNVEVIER YNKTVLQRGW EAFVDANHIQ ENNFMLFHHI EKSRFEVLIL  120
ESDGCEKVFP CAGVRNTPSI QERRLDSVDI SSSYSHDTTE SSGSQRFARC QRSSCSHRGR  180
TANMAATSSS FEESGEDASS ENTSFESDSL EIAPKADYVL SSRRYLSEAQ RKKVIALIQE  240
IKPEITVFVS IMRKCNVQSS GSYLVISKEY ALAHFPHETT YLTLQRPGKS KKWHPRFYIR  300
NDRRVYMLRG QWLDFVRDNH VQEGDICLLL PEKTGRKFTL TVYLLRATET HSSAEMASLV  360
HIKESTDGEH VSSESSSMKE NSDGSLNSND SGGPSDPLYI VPARSCLSRS QKRIIEAKVQ  420
AIQSEVPIYI VIMKSSSVVV SKQMLEFGAH YAAAYLPARK QTMVLQCNGK IWNTDMVIRN  480
GHRLFLRGGW PKFVCDNGLR VGDMCLFELK NGSKLTMEVH VISREEF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.359140.0callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG683700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022679276.10.0B3 domain-containing protein Os03g0619600
SwissprotQ6AV211e-179Y3982_ORYSJ; B3 domain-containing protein Os03g0619800
TrEMBLA0A368SHL10.0A0A368SHL1_SETIT; Uncharacterized protein
STRINGPavir.Ia01278.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.13e-19B3 family protein