PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG206100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 80aa    MW: 8933.43 Da    PI: 10.2892
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG206100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3443.9e-1429783384
                         -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84
                         + + ++    g++W+ ++ + +++++ +l +GW +F+++ngL++gD+++F l
  Pavir.9NG206100.1.p 29 G-QAVVLECMGKTWKTQMVIHNGRRW-FLNGGWAKFARDNGLRVGDICLFDL 78
                         3.45666679********77777766.6999*******************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.266179IPR003340B3 DNA binding domain
CDDcd100174.85E-14176No hitNo description
Gene3DG3DSA:2.40.330.102.6E-17678IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-151278IPR015300DNA-binding pseudobarrel domain
PfamPF023628.2E-121978IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MKNNNVGDAQ KWMLELGVRY AAVHLPASGQ AVVLECMGKT WKTQMVIHNG RRWFLNGGWA  60
KFARDNGLRV GDICLFDLK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.375681e-58callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG206100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797620.12e-53B3 domain-containing protein Os03g0619800-like isoform X3
SwissprotQ6AV223e-19Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLA0A2S3IK601e-52A0A2S3IK60_9POAL; Uncharacterized protein
STRINGPavir.Ia01277.1.p8e-54(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.14e-07B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]