PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG206000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 820aa    MW: 91465.5 Da    PI: 8.6725
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG206000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.31.5e-147498163099
                          ..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  30 keesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          +++++tl+l+   g++We k+ + +++++ ++ +GW +F++ ngL++gD+++F+l+++++ ++ v ++rk
  Pavir.9NG206000.1.p 749 PTKGQTLVLQ-CGGKTWEAKMMFHNGRRW-FINGGWPNFARGNGLRVGDICLFELKKKEKLTMAVYIIRK 816
                          3456566655.499*******99888877.5899**********************99*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.40.108.6E-6355IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF579039.75E-6354IPR011011Zinc finger, FYVE/PHD-type
PROSITE patternPS013590550IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:2.40.330.102.3E-14516623IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-14517622IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.026524624IPR003340B3 DNA binding domain
CDDcd100171.99E-14524621No hitNo description
PROSITE profilePS5086310.941525624IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.2E-19712816IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-17713816IPR015300DNA-binding pseudobarrel domain
CDDcd100173.68E-16718815No hitNo description
SMARTSM010198.4E-6720817IPR003340B3 DNA binding domain
PfamPF023621.5E-12748816IPR003340B3 DNA binding domain
PROSITE profilePS5086312.506761817IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MNIVCEVCGD IGFRHILLCC RDCKCSAVHQ YCLEKVVFDA SLLEWFCYEC LQKRSEITCV  60
RSVEKVPSER PPSHAHFGSI VHQPISKRVE STRDSGAWKN RKSKSFVTIY ASLNKKYPSQ  120
KKRTKNKSNM RPMGNCTNRG RIDKISAHTS AKASYSCEII ETESAKSNNG NNQQVDHENP  180
GTFNIKQPSP LIVNCLGTSG DTDQSHMLET MEELARKSKK TTKIPTAEFK GLVMNRENVV  240
LRSNKLGSSC STAELGNLVL EKSRGKSNSM KDSGGNHDNQ TNQHASVGCK NMEVKSVKDK  300
ETVVAADQNK YGAVGSLRNS MDKSEVHGDS NSNSNSKSNS NIIDGLMPER EKEEIRFQLD  360
YRAKYELPQR SIAANVPQLP TLQNDAVDKV TSYSANDGCE ELFSCRGIKN IPSVRERSVD  420
SVDISSISQH DTTEASESSE SLAEHQKGSS CRHGKTLKKM AAASSSSEES GEDIPSENLS  480
LESDDLRSSL GADYVLSYRT YLSKAQKGRV MKLIKEIQPE FTVYVATMRK TSVQPPGPYL  540
GITKEYALAH FPDKSTSVTL EMPGTSKKWH PKFYKRNESR KNFLMGQWLD FICDNHVQEG  600
DIVLLFPTKG GGRSTFTVYI LHETATHSIG RAGFQRVGSC PGGSTTKMAS EVHIEEEPTT  660
GNHISQESDM HEIPHESLES EDSDPFQPPY FVPCKSPLSK SQKRIVEERV RAIRSEIPLC  720
VAVMKNNNVG VAQRWMLELA SRYGSVYLPT KGQTLVLQCG GKTWEAKMMF HNGRRWFING  780
GWPNFARGNG LRVGDICLFE LKKKEKLTMA VYIIRKEQF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.306390.0callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG206000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797622.10.0B3 domain-containing protein Os03g0619800-like
TrEMBLA0A2T8I1F40.0A0A2T8I1F4_9POAL; Uncharacterized protein
STRINGPavir.Ia01276.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.13e-06B3 family protein