PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG140700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GeBP
Protein Properties Length: 366aa    MW: 38962.3 Da    PI: 6.6055
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG140700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57386.43.7e-2779173297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++ ql+eK+rrLK+K++  +++++ g +p+  ++hd+++f+l
  Pavir.9NG140700.1.p  79 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRAQLSEKLRRLKNKYRSVSARVAGGLDPARLAPHDRDVFHL 167
                          79*******************.556878888*********************************************************** PP

               DUF573  92 skkiWg 97 
                          ++++W+
  Pavir.9NG140700.1.p 168 CSRLWD 173
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.1E-2580173IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MASGQQTLPV PAPVPPNPNP TAPADPTPPA GARKLPIKRR SPRPSSSPPS SSSPASSDPL  60
HAPAPAGGAG SDQQQPPFKF QRIWSESDEL RFLQGLLGCG AQGLVFPRDL NVFYDRFSES  120
MPQPYTRAQL SEKLRRLKNK YRSVSARVAG GLDPARLAPH DRDVFHLCSR LWDPANAATS  180
PFASSAGASG NKRRRSNPRG TQLLPPDASG DSNSHDYNGI GSSAPGLFPD VSNGEDVFYL  240
EQESGHLGDH EGATLDSKFG VIVQEQPEAV AALPNGNNGI GNEIGDHKVV VPCSNEHRMA  300
NAVLDVFEEC LREAKASGII NGGNVGGGAE ESELAKRWRA QRMDELDVLN WRLRLLVEDA  360
AAAGH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.196470.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9677790.0EU967779.1 Zea mays clone 306034 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025791535.10.0probable transcription factor At4g00390
TrEMBLB6T7U50.0B6T7U5_MAIZE; Putative uncharacterized protein
STRINGSb01g010570.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.13e-12DNA-binding storekeeper protein-related transcriptional regulator