PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG137100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 285aa    MW: 29917.6 Da    PI: 8.1019
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG137100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK73.13.6e-232268450
               RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                         ++s e++sk Fslpi++AA+ Lgvc++vLKriCR yGI RWP+Rk+ 
  Pavir.9NG137100.1.p 22 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSYGIVRWPYRKLV 68
                         6899*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.642590IPR003035RWP-RK domain
PfamPF020421.8E-202368IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MASSAPAPQP QPQPLPKPTR VSLSYEEISK LFSLPIAEAA SILGVCTSVL KRICRSYGIV  60
RWPYRKLVSG KAGDDTKGPE REKAKELLEL SKIAKQKAFS PSGSPVVSTS TSQGAAKSQQ  120
GSSKAGQLSV SPPAVKQNAS ASLAHGSQAK AIPSYMDGFK YGFPSSGLSC ETMKWWGGSS  180
DSDCAPTKDG SCEAHGEASK GMTDDDELDW GADEAEAEAD GAVTAEASAQ LCSLRRKAVD  240
DGRKLLNGDT SRGQDFSRLN KRQKLALAQV FGASLPDVVL VFSE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.166630.0callus| leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG137100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025793833.10.0protein NLP7-like
TrEMBLA0A2T8I1220.0A0A2T8I122_9POAL; Uncharacterized protein
STRINGPavir.J24144.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.11e-10RWP-RK domain-containing protein