PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG646700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 323aa    MW: 35097.4 Da    PI: 4.6131
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG646700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-1969121456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++++  +q+++Le++Fe +++++ +++ ++A+ lgL+ rqV vWFqNrRa++k
  Pavir.9KG646700.1.p  69 KRRLAVDQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWK 121
                          4578899*********************************************9 PP

2HD-ZIP_I/II125.62.2e-4067159193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+ +qv++LE++Fe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktk lE+d++aL+++++al+++ ++L++++++L++e
  Pavir.9KG646700.1.p  67 EKKRRLAVDQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWKTKTLERDFAALRARHEALRADCDALRRDKDALAAE 156
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          ++e
  Pavir.9KG646700.1.p 157 IRE 159
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-1861123IPR009057Homeodomain-like
PROSITE profilePS5007116.37463123IPR001356Homeobox domain
SMARTSM003892.4E-1966127IPR001356Homeobox domain
CDDcd000866.01E-1668123No hitNo description
PfamPF000468.7E-1769121IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-2075122IPR009057Homeodomain-like
PRINTSPR000314.4E-594103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000314.4E-5103119IPR000047Helix-turn-helix motif
PfamPF021833.4E-13123164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MKRQSKRPAS SHESTEEGEK LAFAEDEALA ARNMEHEEAE PELDDADDDE DELASGRAGR  60
SPGGLGEKKR RLAVDQVRAL ERCFETDNKL DPDRKSRIAR DLGLQPRQVA VWFQNRRARW  120
KTKTLERDFA ALRARHEALR ADCDALRRDK DALAAEIREL RQKLSKPEAA AKLEAAANDA  180
AAEERQATAG ASAAAVCKDG SSDSDSSVVF NDVEASPYSG AAFEQPAFAG FGAPFLDTSA  240
AVTTGCSSLS MFETKWQQAP ACPYDSYKSS GGVYGFTEEW FASSDVIGSG DCAASFFSEE  300
HASSLNFGWC ASSTEAWERA RL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.201820.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9KG646700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798128.11e-173homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-105HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A3L6TL261e-179A0A3L6TL26_PANMI; Homeobox-leucine zipper protein HOX13-like
STRINGPavir.Ib00562.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-30homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]