PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG429500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 446aa    MW: 49030.5 Da    PI: 5.9805
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG429500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.68e-35227281155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Pavir.9KG429500.1.p 227 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 281
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.967224284IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-33225283IPR009057Homeodomain-like
SuperFamilySSF466893.76E-18226281IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-26227281IPR006447Myb domain, plants
PfamPF002495.1E-10229280IPR001005SANT/Myb domain
PfamPF143791.6E-25310357IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MKNFNLRQPE NSRVFGAMSS SLPILPNSLK ECFPRPHNPQ HIQMSRQLPN DSMPLRNGTP  60
QSATLHPRTR VMGASYSGYS ANPLDSLSNQ SMVAPFISQS SNIDVFQSLS DNTPVAHTEA  120
TWFPSSMDVL PVYTDNIAAP DNQIHSSSSA MTSDEVAKQN DWWAEIMNDD WKDILDATAT  180
DSQSKAMMQP SNSTASLPAV NQSASSHSGE ICPVASPPNS GNASAAKQRM RWTPELHECF  240
VDAVNQLGGS EKATPKGVLK LMKVDGLTIY HVKSHLQKYR TARYKPDLSE GTSEKRTTTE  300
ELSLDLKTSM DLTEALRLQM EVQKRLHEQL EIQRKLQLRI EEQGKYLQMM FEKQCKSSTE  360
NVQDPSSGDT SANPSSDPSN SANKDNSAAM DQNRIGDSPE TAELGEQSTQ LCGKQKITEI  420
NSDSNAAADG GHGITKEKRR KLQDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-31226285160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.49640.0callus| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9KG429500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794590.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_025794591.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX90.0PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A2S3IR130.0A0A2S3IR13_9POAL; Uncharacterized protein
STRINGPavir.Ia03429.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-72phosphate starvation response 1