PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG100200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 532aa    MW: 59270.5 Da    PI: 8.1986
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG100200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.25.4e-17421201397
                          TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          ++ +++p++f++++ gk   s t++le+++g +++v++  + ++++++++ GW+ Fv+a++++e+D+++F+ +++s f   v ++
  Pavir.9KG100200.1.p  42 KHSMIVPNRFVKHFAGK--LSGTIKLESPNGSRYDVEV--TEHRNKMMFRHGWEAFVDAHHIEENDSLLFRNIETSVF--EVLIL 120
                          5779*******888877..677****************..*******************************7777777..56555 PP

2B350.83.1e-164445281299
                          HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          ++++l l  ++a++  ++  +++t++l +  g+ W+ k+ ++++ ++ +l++GW++Fv+ ngL++gD+++F+l+++++ +++v+++++
  Pavir.9KG100200.1.p 444 SRSMLELGSRYATAVHLPA-RGQTVVL-QCMGKIWKTKMVFQRGHRW-FLSGGWSKFVHGNGLRVGDICLFELKDKTKLTMKVHIISR 528
                          5566777777777777664.5556665.559********99999877.5899*********************999*********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.7E-2027125IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-2129129IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.12630123IPR003340B3 DNA binding domain
CDDcd100179.26E-1932121No hitNo description
SMARTSM010191.7E-933123IPR003340B3 DNA binding domain
PfamPF023622.3E-1542119IPR003340B3 DNA binding domain
SuperFamilySSF1019361.61E-13241332IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.6E-10241332IPR015300DNA-binding pseudobarrel domain
CDDcd100172.24E-13248329No hitNo description
SMARTSM010190.36252334IPR003340B3 DNA binding domain
PROSITE profilePS508637.965281332IPR003340B3 DNA binding domain
PfamPF023621.7E-7286330IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-19423527IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.16E-18424527IPR015300DNA-binding pseudobarrel domain
CDDcd100172.02E-18429527No hitNo description
SMARTSM010191.3E-9431529IPR003340B3 DNA binding domain
PROSITE profilePS5086312.562433529IPR003340B3 DNA binding domain
PfamPF023623.6E-14444528IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MACAGGSRMK KPCEHCQRYL DHLDEKNQTM SCFLRRMTAN PKHSMIVPNR FVKHFAGKLS  60
GTIKLESPNG SRYDVEVTEH RNKMMFRHGW EAFVDAHHIE ENDSLLFRNI ETSVFEVLIL  120
DSDGCEKMFR CASIKNTPSV GERSVHSVDI SSSSQHDTIE SSGSERVARC VKGSSSRRGK  180
TSKMAVTSSS SGGSGEDIPS EEESFESDDL QKPPGADYII SCRSRLSGEQ KERVIALIEE  240
IEPEIDVYVA VMLKCNVHPR APFVVITKEY AFAHFPHGNA DITLQRPDRS THMLGGQWSD  300
FVRDNHVQEG DICVFLPTNG GRRFTFTVYL LCAIATHSRR GAGFQRVGPC PGGPSANMAS  360
EIHIKEEPTD GEHVSSESNM HKISHESLES EDSGGPSQPP YFLPCKSGLS KSQKKVIVER  420
VRAIQSEVPI YVAIMRKSSL AVPSRSMLEL GSRYATAVHL PARGQTVVLQ CMGKIWKTKM  480
VFQRGHRWFL SGGWSKFVHG NGLRVGDICL FELKDKTKLT MKVHIISREE L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9KG100200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792770.10.0B3 domain-containing protein Os03g0619600-like isoform X1
RefseqXP_025792772.10.0B3 domain-containing protein Os03g0619600-like isoform X1
RefseqXP_025792773.10.0B3 domain-containing protein Os03g0619600-like isoform X1
RefseqXP_025792774.10.0B3 domain-containing protein Os03g0619600-like isoform X1
RefseqXP_025792775.10.0B3 domain-containing protein Os03g0619600-like isoform X1
SwissprotQ6AV210.0Y3982_ORYSJ; B3 domain-containing protein Os03g0619800
TrEMBLA0A368SHL40.0A0A368SHL4_SETIT; Uncharacterized protein
STRINGPavir.Ib02115.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.15e-16B3 family protein