PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG029500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GeBP
Protein Properties Length: 367aa    MW: 39141.5 Da    PI: 6.5209
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG029500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57383.92.2e-2680174297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++ ql+eK+rrLK+K++  +++++ g +p+  ++hd+++++l
  Pavir.9KG029500.1.p  80 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRAQLSEKLRRLKNKYRSVSARVAGGLDPARLAPHDRDVLHL 168
                          79*******************.556878888*********************************************************** PP

               DUF573  92 skkiWg 97 
                          ++++W+
  Pavir.9KG029500.1.p 169 CSRLWD 174
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.9E-2481174IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MASGQQALPV PAPVPPNPNP TAPADPTPPA GARKLPIKRR SPRPSSSPPS SSSPASSDPL  60
RAPGGGGAGA GSDQQQPPFK FQRIWSESDE LRFLQGLLGC GAQGLVFPRD LNVFYDRFSE  120
SMPQPYTRAQ LSEKLRRLKN KYRSVSARVA GGLDPARLAP HDRDVLHLCS RLWDPANAAT  180
SPFASSAGAS GNKRRRSNPR GTQLLPPDAS GDSNPHDYNG ISSSAPGLFP DVSNAEDVFY  240
LEQESGHLGD HEGATLDSKF GVIVQEQPEA VAALPNGNNG IDNEIEDHKV VVPRSDEHRM  300
ANAVLDVFEE CLREAKASGI INGGNVGGSA EESELAKRWR VQRIDELDVL SRRLRLLVED  360
AAAAGH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.196471e-172callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.10.0uncharacterized protein LOC100276272
TrEMBLB6T7U50.0B6T7U5_MAIZE; Putative uncharacterized protein
STRINGSb01g010570.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.21e-11DNA-binding storekeeper protein-related transcriptional regulator