PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG309900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 505aa    MW: 57663.6 Da    PI: 8.7577
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG309900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS46.94.6e-151822812117
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+av+++++  a++lL+++++ as +gd++qR+a++    L + l+            +++    + e l+a+kl++ ++ + 
  Pavir.8NG309900.1.p 182 RTLLISCAHAVATNNHIGASKLLKQIKQYASATGDATQRVAHCSQ--LWQLLMA----------ERPS----TLEFLKAYKLYYVACCFK 255
                          789**************************************9853..5555544..........3333....5899************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDf 117
                          k++      +Il+a+ g++++Hi+D+
  Pavir.8NG309900.1.p 256 KVALSYSTMTILQAMVGKRKLHIVDY 281
                          *************************8 PP

2GRAS1241.8e-38283497137373
                 GRAS 137 egppslRiTgvgspesg..skeeleetgerLakfAeelgv.pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvslese 223
                          +g p+++iT++g+p+ +   +e++ee+g rL+k A+e+g+ +f+f++ ++k++ed+++e+L+++ +E+l+                  ++
  Pavir.8NG309900.1.p 283 GGLPEVKITAIGPPKLKscLAERIEELGCRLKKWANEFGLdSFKFHT-IMKKWEDVHIEDLNTDIDEVLVT-----------------KP 354
                          6789*********99998899*******************56*****.7******************9863.................35 PP

                 GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetle 313
                          rd vL+ +k+++P+v++ +  ++++ ++sFl+rf e ++yy+alfd l+a++pres+ r+++E+++lgr + n++a eg + ++r e+++
  Pavir.8NG309900.1.p 355 RDIVLSNIKKMRPDVFIQSILNCSC-GSSFLTRFREVMSYYMALFDILDATMPRESKSRAVLEQFVLGRPALNIIAGEGLDLVQRPEKYR 443
                          7889*********************.679************************************************************* PP

                 GRAS 314 kWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          +W+ r ++aG++++p+        k  ++k + + + + +  ++l++gW++  L++ S W
  Pavir.8NG309900.1.p 444 QWQVRNQRAGLRQLPFVV------KDTVQKQHHKNFLIGQYGQWLLQGWMGLVLFAHSTW 497
                          **************9864......44566666677************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.378155484IPR005202Transcription factor GRAS
PfamPF035141.6E-12182281IPR005202Transcription factor GRAS
PfamPF035146.0E-36283497IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MMLPYISRVL LEDDLDDNKL NDHPALLQVQ QPFAQILSSS SYGANTANTD GAKHLLQDGR  60
DDESTLNHNS ALSMGTYIVQ VFLKGMEEAN MLLPRDNKFR GDKRYNRDHH MEEETRTSKA  120
AKTIMDQEEN CANEMLNEMM LHAYETCIRG MEELRVSMDN KVEKENRKKR NKAAKGNVVD  180
IRTLLISCAH AVATNNHIGA SKLLKQIKQY ASATGDATQR VAHCSQLWQL LMAERPSTLE  240
FLKAYKLYYV ACCFKKVALS YSTMTILQAM VGKRKLHIVD YKGGLPEVKI TAIGPPKLKS  300
CLAERIEELG CRLKKWANEF GLDSFKFHTI MKKWEDVHIE DLNTDIDEVL VTKPRDIVLS  360
NIKKMRPDVF IQSILNCSCG SSFLTRFREV MSYYMALFDI LDATMPRESK SRAVLEQFVL  420
GRPALNIIAG EGLDLVQRPE KYRQWQVRNQ RAGLRQLPFV VKDTVQKQHH KNFLIGQYGQ  480
WLLQGWMGLV LFAHSTWVAE YTSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-151854598328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.13e-75GRAS family protein