PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG309800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 582aa    MW: 66259.2 Da    PI: 7.2136
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG309800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3091.1e-942025732373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+av+++++  + +lL++++++as +gd++qR+a++ft++L+arl++++s+l k l +++ s    +e l+a++l++ ++ + 
  Pavir.8NG309800.1.p 202 RTLLISCAQAVATDNHLGVCELLKKIKKHASTTGDATQRVAQCFTKGLEARLVGTGSQLWKLLMAERPS---IVEFLKAYRLYFAACCFN 288
                          789**********************************************************99999988...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv.pfef 178
                          k+s      +I  a+ g++++Hi+D++   G+QW+ Ll+ LasR++  p++RiT++g+++ +   +e++ee+g rL+k A+e+g+ +f+f
  Pavir.8NG309800.1.p 289 KVSLSFSTMTIFHAMVGKRKLHIVDYGTHFGFQWAGLLRLLASREGVLPEVRITAIGPSKLKscPAEQIEELGCRLSKCAHEFGLaSFKF 378
                          **********************************************************8877999*******************957*** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          ++ ++k++ed+++e+L+++++E+l+Vn  ++ h+l+desv  +   +rd+vL+ +k+++P+v+v +  ++++ ++sFl+rf e ++yy++
  Pavir.8NG309800.1.p 379 HT-IMKKWEDVRIEDLNTDTDEVLVVNDLFSFHTLMDESVFYDGqnPRDTVLNNIKKMRPDVFVQSILNCSC-DSSFLTRFREVMSYYMT 466
                          **.7***********************************97765559************************9.889************** PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          +fd lea++pres+ r+++E+++lgr + n++aceg + +er e++++W+ r ++aG++++pl+ ++++  k ++rk++ + + + ++ +
  Pavir.8NG309800.1.p 467 IFDILEATMPRESKSRVVLEQFVLGRPAFNIIACEGPDLVERPEKYRQWQVRNQRAGLRQLPLKLRIVEVTKDIVRKHHHKDFLICQDGQ 556
                          *******************************************************************************888******** PP

                 GRAS 357 slvlgWkdrpLvsvSaW 373
                          +l++gW++r L++ S W
  Pavir.8NG309800.1.p 557 WLLQGWMGRVLFAHSTW 573
                          ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.23175554IPR005202Transcription factor GRAS
PfamPF035143.6E-92202573IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MMLPYISRVL LEDDIDDNKL NDHPALLQVL QPFAQILSSS STSSYGANTC NTDGAKDLLQ  60
HGGDDESTLN RNSALSKGKD AVLAFLKGME EANMLLPKDN KFIGDVQVNP MVWESSNHTG  120
DKKRYDRDNH MEEQIRTSKA AKMIKDPEEN YANEMLDEMM MHAYETCIRG MEELRVSMDN  180
KVDKENRKKC NKAVKDNVVD IRTLLISCAQ AVATDNHLGV CELLKKIKKH ASTTGDATQR  240
VAQCFTKGLE ARLVGTGSQL WKLLMAERPS IVEFLKAYRL YFAACCFNKV SLSFSTMTIF  300
HAMVGKRKLH IVDYGTHFGF QWAGLLRLLA SREGVLPEVR ITAIGPSKLK SCPAEQIEEL  360
GCRLSKCAHE FGLASFKFHT IMKKWEDVRI EDLNTDTDEV LVVNDLFSFH TLMDESVFYD  420
GQNPRDTVLN NIKKMRPDVF VQSILNCSCD SSFLTRFREV MSYYMTIFDI LEATMPRESK  480
SRVVLEQFVL GRPAFNIIAC EGPDLVERPE KYRQWQVRNQ RAGLRQLPLK LRIVEVTKDI  540
VRKHHHKDFL ICQDGQWLLQ GWMGRVLFAH STWVAEDTSS Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-322055738374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
RefseqXP_008677892.10.0PREDICTED: scarecrow-like protein 34 isoform X2
RefseqXP_008677891.10.0PREDICTED: scarecrow-like protein 34 isoform X1
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-111GRAS family protein