PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG296700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 434aa    MW: 49177.9 Da    PI: 8.0608
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG296700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.58.3e-92564253373
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                           lL++cA+av++g+   aq+lL++++++as++gd +qRla++f ++L+arla+++s+l ++l+++      ++e l+a+kl+  ++ + +
  Pavir.8NG296700.1.p  56 ALLIRCAQAVAAGSVMTAQELLKQIKQNASSTGDDTQRLAQCFSKGLEARLAGTGSQLWQSLTAEGPL---VIEYLKAYKLYMAACCFNR 142
                          69***************************************************999999999888887...******************* PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          ++ +    +I  a++g++++Hi+D++  +G+QW+ Ll+ +a+R++gpp+++iT++++ ++    +e +e tg+rL+k A+e+gvpf+f+ 
  Pavir.8NG296700.1.p 143 VALFFNIMTIEHAMAGKSKLHIVDYGPHHGFQWAGLLRWMANREGGPPEVKITAISRLQPRscPSEGIEDTGHRLSKCAREFGVPFKFHS 232
                          *********************************************************9999999************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                           ++ r+e++  ++L+++p+E+l+V   ++   l+des   ++  +rd+vL+ +++++P+v++    ++++ ++sFl+rf eal +ysalf
  Pavir.8NG296700.1.p 233 -ITARWETICNDNLKTDPDEVLIVIDLFNFSILMDESIYFDNpsPRDTVLNNIRKMRPDVFIQGVVNSSY-GTSFLARFREALFHYSALF 320
                          .699*********************************98877779**********************999.679**************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+++a++pre + r+++E+ +lg  + nv+aceg + ++r e++++W+ r ++aG++++pl+ +++k  k  + k + + + v e+ ++l
  Pavir.8NG296700.1.p 321 DMFDATIPRECKLRSVLEQGMLGHTVLNVIACEGVDLVNRPERYRQWQVRNQRAGLRQLPLKPNIVKVLKEKVMKDHHKDFFVGEDGQWL 410
                          **********************************************************************9999999788********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L++ S W
  Pavir.8NG296700.1.p 411 LQGWKGRILYAHSTW 425
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.87628406IPR005202Transcription factor GRAS
PfamPF035142.9E-8956425IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MMMMEELGEM FDKMMLRGYE TCIKDMEKLR SAKADEAMNN KKGGSKMRTD VVDLCALLIR  60
CAQAVAAGSV MTAQELLKQI KQNASSTGDD TQRLAQCFSK GLEARLAGTG SQLWQSLTAE  120
GPLVIEYLKA YKLYMAACCF NRVALFFNIM TIEHAMAGKS KLHIVDYGPH HGFQWAGLLR  180
WMANREGGPP EVKITAISRL QPRSCPSEGI EDTGHRLSKC AREFGVPFKF HSITARWETI  240
CNDNLKTDPD EVLIVIDLFN FSILMDESIY FDNPSPRDTV LNNIRKMRPD VFIQGVVNSS  300
YGTSFLARFR EALFHYSALF DMFDATIPRE CKLRSVLEQG MLGHTVLNVI ACEGVDLVNR  360
PERYRQWQVR NQRAGLRQLP LKPNIVKVLK EKVMKDHHKD FFVGEDGQWL LQGWKGRILY  420
AHSTWVAEDA ISE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-29584258374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.310180.0callus
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450073.10.0hypothetical protein SORBIDRAFT_05g027795, partial
TrEMBLC5Y1S70.0C5Y1S7_SORBI; Putative uncharacterized protein Sb05g027795 (Fragment)
STRINGSb05g027795.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-117SCARECROW-like 14