PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG296200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 592aa    MW: 65985.8 Da    PI: 6.6439
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG296200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS314.32.6e-962135822373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cA+av + + + a++lL++++++asp+gd++qRla +f+++L+arla+++s++y++l++ +t+     e l+a++lf  ++ + 
  Pavir.8NG296200.1.p 213 HTLLLHCAKAVID-NRRSADELLKQIKDHASPTGDATQRLAYCFAQGLEARLAGTGSQVYRSLTADRTP---LLEFLKAYQLFMSTCCFR 298
                          679********97.8999*********************************************999999...****************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+++  aN+aI + + g +++Hi+D+++  G+QWp Ll+ L +R++gpp++RiT ++ p++g   ++ + e+g+ L++ A++l vp++f 
  Pavir.8NG296200.1.p 299 KVAFHFANKAIFDVAIGRSKLHIVDYGLHSGFQWPELLRLLGARDGGPPEVRITSIDLPQPGfrPANHIAEMGHHLSNCARQLCVPLKFG 388
                          *************************************************************9*9************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          + v+ +++++++++L+v+p+E++++n  ++  +l+desv ++   +rd vL+ + +++P+v+v    + ++ ++ Fl rf eal y+sa+
  Pavir.8NG296200.1.p 389 A-VVAQWHTISIDDLNVEPDEVIVINDLFNFRTLMDESVVTDRssPRDVVLSNIAKMKPDVFVQGIINGSY-GTFFLSRFREALFYHSAM 476
                          *.7999********************************98766669*************************.789*************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd+l+a++pres+ r ++Er ++g+ + n++aceg++r er et+++W+ r ++aG++++pl+ + ++ ++ ++++ + + + +ee++++
  Pavir.8NG296200.1.p 477 FDMLDATMPRESRLRLVLERDIFGWVALNAIACEGEDRLERGETYKQWQIRNRRAGLRQLPLNRESVNMVRNIVKNQYHKDFVIEEDQQW 566
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l++gWk+r L++ S+W
  Pavir.8NG296200.1.p 567 LLQGWKGRILLAHSMW 582
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.19186563IPR005202Transcription factor GRAS
PfamPF035148.9E-94213582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MAPPVFPGDA DEAASSYLHL SRIALLMEEQ EAEDVAELSP DHPALLHAQL PFSQILSGAP  60
FSPDQDPVFP GHRGSPNGGG HDKEEYGTDM FTASFFRGVD EATKFLPADT ADEPLRSKES  120
AGDRGRRDRH SSGGGEQEAE AGRASKLATA ESEEASAREM FDEMMLRGFD ACAKGMGGLT  180
ISMENVPTAD NKKARKRTRT RGKRRASKVV DLHTLLLHCA KAVIDNRRSA DELLKQIKDH  240
ASPTGDATQR LAYCFAQGLE ARLAGTGSQV YRSLTADRTP LLEFLKAYQL FMSTCCFRKV  300
AFHFANKAIF DVAIGRSKLH IVDYGLHSGF QWPELLRLLG ARDGGPPEVR ITSIDLPQPG  360
FRPANHIAEM GHHLSNCARQ LCVPLKFGAV VAQWHTISID DLNVEPDEVI VINDLFNFRT  420
LMDESVVTDR SSPRDVVLSN IAKMKPDVFV QGIINGSYGT FFLSRFREAL FYHSAMFDML  480
DATMPRESRL RLVLERDIFG WVALNAIACE GEDRLERGET YKQWQIRNRR AGLRQLPLNR  540
ESVNMVRNIV KNQYHKDFVI EEDQQWLLQG WKGRILLAHS MWVADGASSG W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-402165828374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663691.10.0PREDICTED: scarecrow-like protein 14
TrEMBLJ3NAH50.0J3NAH5_ORYBR; Uncharacterized protein
STRINGOB11G28110.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-130SCARECROW-like 14