PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG296100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 625aa    MW: 69255.1 Da    PI: 6.2676
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG296100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3481.5e-1062416122373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                            lLl+cA+av+++d + a+ lLa+++ ++sp+gd+ qRla++f+e+L+arla+++s+ly++l +++ts    ++ l+a++lf  ++ + 
  Pavir.8NG296100.1.p 241 HALLLRCAQAVAADDRRVAHDLLAQVRRHSSPTGDAAQRLAHCFAEGLEARLAGTGSRLYHSLMVRPTS---AVDFLKAYQLFMAACCCK 327
                          579*****************************************************************9...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+++   N++I +a++g +r+Hi+D++is+G+QWp Ll+ La+R++gpp++RiTg++ p++g   + ++eetg+rLa  A+elgvpf+f+
  Pavir.8NG296100.1.p 328 KVAFTFSNKTIFDAAAGRRRLHIVDYGISYGFQWPGLLRGLAARQGGPPEVRITGIDLPQPGfrPAYQIEETGRRLAGCARELGVPFRFR 417
                          *************************************************************99999************************ PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            +a + e++++e+L+++pgE+l+V++  +  +l+desv l    +rdevL  +++++P+v+++   +  ++++ F +rf e l y sa 
  Pavir.8NG296100.1.p 418 G-IAAKRETISPEDLDIDPGEVLVVSSLCHFRHLMDESVVLGRpsPRDEVLGNIRRMRPDVFIHGVVNGGYGTTYFPTRFRELLFYWSAQ 506
                          *.69999*******************************99876669******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd lea++pres er  vEr ++gr++vnv+acega+r+er et+++W++r ++aG++++pl+ +a+k +   +r  + + + v+e++ +
  Pavir.8NG296100.1.p 507 FDLLEATVPRESPERLLVERDIFGRSAVNVIACEGADRVERPETYRQWQARNQRAGLRQLPLEPQAVKVVLDKVRDNYHKDFVVDEDQSW 596
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l+  Wk+r L+ +S W
  Pavir.8NG296100.1.p 597 LLHRWKGRVLYGLSTW 612
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.497214593IPR005202Transcription factor GRAS
PfamPF035145.1E-104241612IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MAAAPEEFLF VHPDPPSPSI FLDLPPTPPH DDPAAFDDMV LPYIARLLMD EEAAGADSFF  60
YQYPDHPALL QAQLPFAQIL SDCTASPSVS ADTGAGRGCS DSDHSPTVAS PAADHATDMV  120
TSAFLKGMEE ATKFLPTNDA LLLLDHTGGH ARGRKNNRHA ATGYDDDDPE PEARRATKLA  180
ATEPDEAGAR QMFDDMMLRE RDICMKGVQQ RLTAGANHTS APRRRRRRGD TSTDDDAVDL  240
HALLLRCAQA VAADDRRVAH DLLAQVRRHS SPTGDAAQRL AHCFAEGLEA RLAGTGSRLY  300
HSLMVRPTSA VDFLKAYQLF MAACCCKKVA FTFSNKTIFD AAAGRRRLHI VDYGISYGFQ  360
WPGLLRGLAA RQGGPPEVRI TGIDLPQPGF RPAYQIEETG RRLAGCAREL GVPFRFRGIA  420
AKRETISPED LDIDPGEVLV VSSLCHFRHL MDESVVLGRP SPRDEVLGNI RRMRPDVFIH  480
GVVNGGYGTT YFPTRFRELL FYWSAQFDLL EATVPRESPE RLLVERDIFG RSAVNVIACE  540
GADRVERPET YRQWQARNQR AGLRQLPLEP QAVKVVLDKV RDNYHKDFVV DEDQSWLLHR  600
WKGRVLYGLS TWVADDADDA TSSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-432446128374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222227RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703949.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK3ZHR40.0K3ZHR4_SETIT; Uncharacterized protein
STRINGSi026116m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-129GRAS family protein