PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG296000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 666aa    MW: 73259.8 Da    PI: 5.1072
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG296000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.23.9e-1012856562373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+av++++ + a++lL ++++++sp+gd++qRla +f+e+L+arla+s+s++yk+l +++ s   ++e l+a++++  +s + 
  Pavir.8NG296000.1.p 285 STLLIHCAQAVATDNRRSATELLRQIKQHSSPRGDATQRLANCFAEGLEARLAGSGSQVYKSLMAERIS---VVEYLKAYQVYLAASCFK 371
                          579************************************************************999998...****************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                           +++   N +I + ++g ++vHi+D++i++G+QWp+Ll  +a+ ++gpp++RiTg++ p++g   + ++eetg rL++ A++lgvpf+f+
  Pavir.8NG296000.1.p 372 MMAFKFSNMTIAKVIAGRKKVHIVDYGIQYGFQWPSLLGYMATLKGGPPQVRITGIDLPQPGfrPASRIEETGCRLSNCASQLGVPFKFH 461
                          *************************************************************9*9************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            ++ r+e++ +++L+++p+E+l+Vn++ +  +l+de v+++s  +rd vL  +++++P+ +++   +a+++++ F++rf eal ++sa+
  Pavir.8NG296000.1.p 462 S-ITARWETIGVDDLNIDPDEVLIVNSIRNFGNLMDEGVDIDSpsPRDVVLGNIRKMKPDAFILFVMNASYSAPFFVTRFREALFFHSAI 550
                          *.699**********************************9999889******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd+l+a++pr++++r  vEr l+++ + nvvaceg +r+er et+++W+ r ++aG++++pl+ +++k ++  +r+ + + + ++ ++++
  Pavir.8NG296000.1.p 551 FDMLDATAPRDNHQRFLVERGLFRKCALNVVACEGLDRVERPETYKQWQVRNHRAGLRQLPLDPDVVKAVRENVRNLYHKDFVIDVDHQW 640
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l+ gWk+r L+++S W
  Pavir.8NG296000.1.p 641 LLEGWKGRILYAMSTW 656
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.006258637IPR005202Transcription factor GRAS
PfamPF035141.4E-98285656IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MEEDMDDNFL YQFPDHPALL QAQEPYARIL SDTNSTASGS AATLSPSSDY DPVQLLVSPL  60
SPDMGLHDTG DDAGTFFLPA QDGVSPGLEQ NPAKSGTAGD ADAFVAGRFG SGTGTGVQSS  120
AFLDIADEQS PAQLGTTTLP LPAGDGDHAV LASAFFSGQN GENMDMLSTA FLKGMEEANK  180
FLPTINNSLL IDQEEGRVNG RGRKNRLNSD DLEAETCRKS KLMVPEPEET GDKVDEMIVN  240
GREMCLKEME ALRITMGSDA KNNSRKGKGR SAKGRRSADE AVDLSTLLIH CAQAVATDNR  300
RSATELLRQI KQHSSPRGDA TQRLANCFAE GLEARLAGSG SQVYKSLMAE RISVVEYLKA  360
YQVYLAASCF KMMAFKFSNM TIAKVIAGRK KVHIVDYGIQ YGFQWPSLLG YMATLKGGPP  420
QVRITGIDLP QPGFRPASRI EETGCRLSNC ASQLGVPFKF HSITARWETI GVDDLNIDPD  480
EVLIVNSIRN FGNLMDEGVD IDSPSPRDVV LGNIRKMKPD AFILFVMNAS YSAPFFVTRF  540
REALFFHSAI FDMLDATAPR DNHQRFLVER GLFRKCALNV VACEGLDRVE RPETYKQWQV  600
RNHRAGLRQL PLDPDVVKAV RENVRNLYHK DFVIDVDHQW LLEGWKGRIL YAMSTWDADD  660
AVSEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-362886568374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-153GRAS family protein