PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG295900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 809aa    MW: 87921.7 Da    PI: 4.5822
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG295900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.32e-1054288001373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++ L++cA+ v++gd + a +lL ++++++sp+gd++qR+a++f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  +s +
  Pavir.8NG295900.1.p 428 LRTMLIHCAQSVATGDRRSAMELLRQIKQHSSPRGDATQRMAHCFAEGLEARLAGTGSQVYQSLMAKHTS---VVEFLKAYKLFTAASSL 514
                          5789***************************************************************999...***************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k+  + aNq+Il av+g +++Hi+ +++++GlQWp Ll+ L++R++gpp++R Tg++ p++g   + ++eetg+rL++ A e+gvpf+f
  Pavir.8NG295900.1.p 515 KKVHIIFANQTILSAVAGRSKLHIVVYGLQYGLQWPGLLHFLSCREGGPPEVRFTGIDLPQPGfrPAYQIEETGRRLSNCALEFGVPFKF 604
                          **************************************************************99999*********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          ++ +a ++e++  e+L+++p+E+l+V +     +l+desv+++   +rd vL+ +++++P+v+++   +  ++++ Fl+rf eal +ysa
  Pavir.8NG295900.1.p 605 QA-IAAKWETVCAEDLNIDPDEVLVVYSECDFSKLMDESVDVDTpsPRDMVLNNIRKMRPNVFILFVMNGTYGAPFFLTRFREALFFYSA 693
                          **.799********************************998776669******************************************* PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          lfd+l+a++pr+++er  +Er ++gr++ nv+acega+r er et+++W+ r ++aG+k++pl+ +++k a+  +++++ + + ++e++ 
  Pavir.8NG295900.1.p 694 LFDMLDATIPRDNDERLLIERDIFGRSALNVIACEGADRAERPETYKQWQVRNHRAGLKQLPLNPEVVKIARDKVKNYYHKDFLIDEDHR 783
                          *******************************************************************************889******** PP

                 GRAS 357 slvlgWkdrpLvsvSaW 373
                          +l++gWk+r L+++S W
  Pavir.8NG295900.1.p 784 WLLQGWKGRVLYAMSTW 800
                          ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.719402781IPR005202Transcription factor GRAS
PfamPF035146.9E-103428800IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MSATPEESLG QGACLAAPEP FSPSVFLDLP PTPRPDGDAD DPASDDDLVL PFISRMLMEE  60
DIDDKFFYQF PDHPALLNAQ QPYAQILLSD DSATTSNSSS AGTAAANSTL SPSSSSDAPA  120
SAEPAWPYDP IELSQLLRSP PYPDTVLGLH DFTADDVDAL LLQGQGEATA GFPPFLDTAG  180
GGAGGGQRQG AASIATQIAA GAGSPSLAAQ NAGTQSSAAD EQDTKTATAS VIPNSVADEQ  240
DAKATNATTL PAADSDPAAL ASAFFSAQSG ESMDMLNMAF LKGMEEAKKF LPTNNSLLID  300
LEDAPGRSLP GDSKPATGFA AAQVKEEVVA DGMLLFGGST TGRGRKNRHT DEDLEAESGR  360
NSKLMMPEQE ETGAGELFDE LMSCNYDGFL KRMNDLRIAM DSESEKSARR VSGKGARGRQ  420
RADEVVGLRT MLIHCAQSVA TGDRRSAMEL LRQIKQHSSP RGDATQRMAH CFAEGLEARL  480
AGTGSQVYQS LMAKHTSVVE FLKAYKLFTA ASSLKKVHII FANQTILSAV AGRSKLHIVV  540
YGLQYGLQWP GLLHFLSCRE GGPPEVRFTG IDLPQPGFRP AYQIEETGRR LSNCALEFGV  600
PFKFQAIAAK WETVCAEDLN IDPDEVLVVY SECDFSKLMD ESVDVDTPSP RDMVLNNIRK  660
MRPNVFILFV MNGTYGAPFF LTRFREALFF YSALFDMLDA TIPRDNDERL LIERDIFGRS  720
ALNVIACEGA DRAERPETYK QWQVRNHRAG LKQLPLNPEV VKIARDKVKN YYHKDFLIDE  780
DHRWLLQGWK GRVLYAMSTW VAEDNNIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-394328008374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.106590.0callus| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9760950.0EU976095.1 Zea mays clone 622740 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-151SCARECROW-like 14