PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG253200.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 209aa    MW: 22851.5 Da    PI: 8.386
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG253200.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP477e-159404778
                         SSEEETTT--SS--S-STTTT-------S--- CS
                  SBP 47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78
                          rfh+lsefDe+krsCr+rL++hn+rrrk+q+
  Pavir.8NG253200.4.p  9 RRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQH 40
                         69***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114114.699138IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.6E-5725IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.47E-12942IPR004333Transcription factor, SBP-box
PfamPF031101.8E-8937IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEKRMIKSRR FHMLSEFDEG KRSCRKRLDG HNRRRRKPQH DLANLGGFFP YHQVNQFEMY  60
PRTIPTACQD SDDMSLVDPQ PPFSISFSRT PKQFPFPHDG GSLLSASRHG HFLVQDGNHT  120
GSSACSHDLS GTLGPECALS LLSSSLHHPS PAGHAQVASA LSRIASTSQQ VAATPVTTAF  180
ASGGSHHVFV PDAALEDPSQ ALPFPWQQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12037KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.8NG253200.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826748.11e-109putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-54SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A3L6PNI81e-119A0A3L6PNI8_PANMI; Putative squamosa promoter-binding-like protein 19
STRINGPavir.Ha00508.1.p1e-149(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-14SBP family protein